Recombinant Human MS4A7 Protein, GST-tagged

Cat.No. : MS4A7-5643H
Product Overview : Human MS4A7 full-length ORF ( AAH20673, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq
Molecular Mass : 52.14 kDa
AA Sequence : MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MS4A7 membrane-spanning 4-domains, subfamily A, member 7 [ Homo sapiens ]
Official Symbol MS4A7
Synonyms MS4A7; membrane-spanning 4-domains, subfamily A, member 7; membrane-spanning 4-domains subfamily A member 7; CD20L4; CFFM4; MS4A8; CD20 antigen-like 4; four-span transmembrane protein 2; CD20/Fc-epsilon-RI-beta family member 4; high affinity immunoglobulin epsilon receptor beta subunit; 4SPAN2; MGC22368;
Gene ID 58475
mRNA Refseq NM_021201
Protein Refseq NP_067024
MIM 606502
UniProt ID Q9GZW8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MS4A7 Products

Required fields are marked with *

My Review for All MS4A7 Products

Required fields are marked with *

0
cart-icon