Recombinant Human MSH2
Cat.No. : | MSH2-28793TH |
Product Overview : | Recombinant fragment corresponding to amino acids 835-934 of Human MSH2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT |
Sequence Similarities : | Belongs to the DNA mismatch repair mutS family. |
Gene Name | MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ] |
Official Symbol | MSH2 |
Synonyms | MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1; |
Gene ID | 4436 |
mRNA Refseq | NM_000251 |
Protein Refseq | NP_000242 |
MIM | 609309 |
Uniprot ID | P43246 |
Chromosome Location | 2p21 |
Pathway | BRCA1-associated genome surveillance complex (BASC), organism-specific biosystem; Colorectal cancer, organism-specific biosystem; Colorectal cancer, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Mismatch repair, organism-specific biosystem; |
Function | contributes_to ADP binding; contributes_to ATP binding; contributes_to ATPase activity; DNA binding; DNA-dependent ATPase activity; |
◆ Recombinant Proteins | ||
MSH2-1138P | Recombinant Pig MSH2 Protein, His-tagged | +Inquiry |
MSH2-12683Z | Recombinant Zebrafish MSH2 | +Inquiry |
MSH2-2456H | Recombinant Human MSH2 Protein, His-tagged | +Inquiry |
MSH2-6982HF | Recombinant Full Length Human MSH2 Protein, GST-tagged | +Inquiry |
MSH2-2763H | Recombinant Human MSH2 protein(441-610 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSH2-4120HCL | Recombinant Human MSH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSH2 Products
Required fields are marked with *
My Review for All MSH2 Products
Required fields are marked with *
0
Inquiry Basket