Recombinant Human MSH2
| Cat.No. : | MSH2-28793TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 835-934 of Human MSH2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Ubiquitously expressed. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT |
| Sequence Similarities : | Belongs to the DNA mismatch repair mutS family. |
| Gene Name | MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ] |
| Official Symbol | MSH2 |
| Synonyms | MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1; |
| Gene ID | 4436 |
| mRNA Refseq | NM_000251 |
| Protein Refseq | NP_000242 |
| MIM | 609309 |
| Uniprot ID | P43246 |
| Chromosome Location | 2p21 |
| Pathway | BRCA1-associated genome surveillance complex (BASC), organism-specific biosystem; Colorectal cancer, organism-specific biosystem; Colorectal cancer, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Mismatch repair, organism-specific biosystem; |
| Function | contributes_to ADP binding; contributes_to ATP binding; contributes_to ATPase activity; DNA binding; DNA-dependent ATPase activity; |
| ◆ Recombinant Proteins | ||
| MSH2-1137H | Recombinant Human MSH2 Protein, His-tagged | +Inquiry |
| MSH2-28175TH | Recombinant Human MSH2 protein, GST-tagged | +Inquiry |
| MSH2-2456H | Recombinant Human MSH2 Protein, His-tagged | +Inquiry |
| MSH2-5739M | Recombinant Mouse MSH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MSH2-162H | Recombinant Human MSH2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSH2-4120HCL | Recombinant Human MSH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSH2 Products
Required fields are marked with *
My Review for All MSH2 Products
Required fields are marked with *
