Recombinant Human MSH2

• Cat.No.: MSH2-28793TH
• Product Overview: Recombinant fragment corresponding to amino acids 835-934 of Human MSH2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT
• Sequence Similarities: Belongs to the DNA mismatch repair mutS family.

Gene Information

• Gene Name: MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ]
• Official Symbol: MSH2
• Synonyms: MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1
• Gene ID: 4436
• mRNA Refseq: NM_000251
• Protein Refseq: NP_000242
• MIM: 609309
• Uniprot ID: P43246
• Chromosome Location: 2p21
• Pathway: BRCA1-associated genome surveillance complex (BASC), organism-specific biosystem; Colorectal cancer, organism-specific biosystem; Colorectal cancer, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Mismatch repair, organism-specific biosystem
• Function: contributes_to ADP binding; contributes_to ATP binding; contributes_to ATPase activity; DNA binding; DNA-dependent ATPase activity