Recombinant Human MSH2 protein(441-610 aa), C-His-tagged
| Cat.No. : | MSH2-2763H | 
| Product Overview : | Recombinant Human MSH2 protein(P43246)(441-610 aa), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 441-610 aa | 
| Form : | 0.15 M Phosphate buffered saline | 
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | TDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAH | 
| Gene Name | MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ] | 
| Official Symbol | MSH2 | 
| Synonyms | MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1; hMSH2; FCC1; COCA1; LCFS2; | 
| Gene ID | 4436 | 
| mRNA Refseq | NM_000251 | 
| Protein Refseq | NP_000242 | 
| MIM | 609309 | 
| UniProt ID | P43246 | 
| ◆ Recombinant Proteins | ||
| MSH2-3787R | Recombinant Rat MSH2 Protein | +Inquiry | 
| MSH2-162H | Recombinant Human MSH2 | +Inquiry | 
| MSH2-10131M | Recombinant Mouse MSH2 Protein | +Inquiry | 
| MSH2-12683Z | Recombinant Zebrafish MSH2 | +Inquiry | 
| MSH2-28175TH | Recombinant Human MSH2 protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MSH2-4120HCL | Recombinant Human MSH2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSH2 Products
Required fields are marked with *
My Review for All MSH2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            