Recombinant Human MSH2 protein(441-610 aa), C-His-tagged

• Cat.No.: MSH2-2763H
• Product Overview: Recombinant Human MSH2 protein(P43246)(441-610 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 441-610 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: TDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAH

Gene Information

• Gene Name: MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ]
• Official Symbol: MSH2
• Synonyms: MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1; hMSH2; FCC1; COCA1; LCFS2
• Gene ID: 4436
• mRNA Refseq: NM_000251
• Protein Refseq: NP_000242
• MIM: 609309
• UniProt ID: P43246