Recombinant Human MSH2 protein(441-610 aa), C-His-tagged
Cat.No. : | MSH2-2763H |
Product Overview : | Recombinant Human MSH2 protein(P43246)(441-610 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 441-610 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | TDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAH |
Gene Name | MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ] |
Official Symbol | MSH2 |
Synonyms | MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1; hMSH2; FCC1; COCA1; LCFS2; |
Gene ID | 4436 |
mRNA Refseq | NM_000251 |
Protein Refseq | NP_000242 |
MIM | 609309 |
UniProt ID | P43246 |
◆ Recombinant Proteins | ||
MSH2-162H | Recombinant Human MSH2 | +Inquiry |
MSH2-3787R | Recombinant Rat MSH2 Protein | +Inquiry |
MSH2-5739M | Recombinant Mouse MSH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSH2-10131M | Recombinant Mouse MSH2 Protein | +Inquiry |
MSH2-1137H | Recombinant Human MSH2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSH2-4120HCL | Recombinant Human MSH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSH2 Products
Required fields are marked with *
My Review for All MSH2 Products
Required fields are marked with *