Recombinant Human MSMB Protein, GST-tagged
Cat.No. : | MSMB-5661H |
Product Overview : | Human MSMB full-length ORF ( AAH05257.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq |
Molecular Mass : | 38.28 kDa |
AA Sequence : | MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MSMB microseminoprotein, beta- [ Homo sapiens ] |
Official Symbol | MSMB |
Synonyms | MSMB; microseminoprotein, beta-; beta-microseminoprotein; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP 94; PSP57; PSP94; seminal plasma beta-inhibin; immunoglobulin binding factor; prostate secreted seminal plasma protein; prostate secretory protein of 94 amino acids; HPC13; PSP-94; |
Gene ID | 4477 |
mRNA Refseq | NM_002443 |
Protein Refseq | NP_002434 |
MIM | 157145 |
UniProt ID | P08118 |
◆ Recombinant Proteins | ||
MSMB-5656H | Recombinant Human MSMB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MSMB-31099TH | Recombinant Human MSMB | +Inquiry |
MSMB-318HF | Recombinant Full Length Human MSMB Protein | +Inquiry |
MSMB-06H | Recombinant Human MSMB protein, GST tagged, GFP Labeled | +Inquiry |
MSMB-3655H | Recombinant Human MSMB, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSMB-4111HCL | Recombinant Human MSMB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSMB Products
Required fields are marked with *
My Review for All MSMB Products
Required fields are marked with *
0
Inquiry Basket