Recombinant Human MSMB Protein, GST-tagged

Cat.No. : MSMB-5661H
Product Overview : Human MSMB full-length ORF ( AAH05257.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq
Molecular Mass : 38.28 kDa
AA Sequence : MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MSMB microseminoprotein, beta- [ Homo sapiens ]
Official Symbol MSMB
Synonyms MSMB; microseminoprotein, beta-; beta-microseminoprotein; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP 94; PSP57; PSP94; seminal plasma beta-inhibin; immunoglobulin binding factor; prostate secreted seminal plasma protein; prostate secretory protein of 94 amino acids; HPC13; PSP-94;
Gene ID 4477
mRNA Refseq NM_002443
Protein Refseq NP_002434
MIM 157145
UniProt ID P08118

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSMB Products

Required fields are marked with *

My Review for All MSMB Products

Required fields are marked with *

0
cart-icon