Recombinant Human MSS51 Protein, GST-tagged

• Cat.No.: MSS51-5669H
• Product Overview: Human MSS51 full-length ORF ( AAH94693.1, 1 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MSS51 (MSS51 Mitochondrial Translational Activator) is a Protein Coding gene.
• Molecular Mass: 77.6 kDa
• AA Sequence: MAPRSRRRRHKKPPSSVAPIIMAPTTIVTPVPLTPSKPGPSIDTLGFFSLDDNVPGLSQLILQKLNMKSYEEYKLVVDGGTPVSGFGFRCPQEMFQRMEDTFRFCAHCRALPSGLSDSKVLRHCKRCRNVYYCGPECQKSDWPAHRRVCQELRLVAVDRLMEWLLVTGDFVLPSGPWPWPPEAVQDWDSWFSMKGLHLDATLDAVLVSHAVTTLWASVGRPRPDPDVLQGSLKRLLTDVLSRPLTLGLGLRALGIDVRRTGGSTVHVVGASHVETFLTRPGDYDELGYMFPGHLGLRVVMVGVDVATGFSQSTSTSPLEPGTIQLSAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHSSPDLMEAWLPTLLLLRDYKIPTLITVYSHQELVSSLQILVELDTHITAVGSNPFMSLKPEQVYSSPNKQPVYCSAYYIMFLGSSCQLDNRQLEEKVDGGI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MSS51 MSS51 mitochondrial translational activator homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: MSS51
• Synonyms: ZMYND17; MSS51; MSS51 mitochondrial translational activator homolog (S. cerevisiae)
• Gene ID: 118490
• mRNA Refseq: NM_001024593
• Protein Refseq: NP_001019764
• MIM: 614773
• UniProt ID: Q4VC12