Recombinant Human MSS51 Protein, GST-tagged

Cat.No. : MSS51-5669H
Product Overview : Human MSS51 full-length ORF ( AAH94693.1, 1 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MSS51 (MSS51 Mitochondrial Translational Activator) is a Protein Coding gene.
Molecular Mass : 77.6 kDa
AA Sequence : MAPRSRRRRHKKPPSSVAPIIMAPTTIVTPVPLTPSKPGPSIDTLGFFSLDDNVPGLSQLILQKLNMKSYEEYKLVVDGGTPVSGFGFRCPQEMFQRMEDTFRFCAHCRALPSGLSDSKVLRHCKRCRNVYYCGPECQKSDWPAHRRVCQELRLVAVDRLMEWLLVTGDFVLPSGPWPWPPEAVQDWDSWFSMKGLHLDATLDAVLVSHAVTTLWASVGRPRPDPDVLQGSLKRLLTDVLSRPLTLGLGLRALGIDVRRTGGSTVHVVGASHVETFLTRPGDYDELGYMFPGHLGLRVVMVGVDVATGFSQSTSTSPLEPGTIQLSAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHSSPDLMEAWLPTLLLLRDYKIPTLITVYSHQELVSSLQILVELDTHITAVGSNPFMSLKPEQVYSSPNKQPVYCSAYYIMFLGSSCQLDNRQLEEKVDGGI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MSS51 MSS51 mitochondrial translational activator homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol MSS51
Synonyms ZMYND17; MSS51; MSS51 mitochondrial translational activator homolog (S. cerevisiae)
Gene ID 118490
mRNA Refseq NM_001024593
Protein Refseq NP_001019764
MIM 614773
UniProt ID Q4VC12

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSS51 Products

Required fields are marked with *

My Review for All MSS51 Products

Required fields are marked with *

0
cart-icon