Recombinant Human MSS51 Protein, GST-tagged
Cat.No. : | MSS51-5669H |
Product Overview : | Human MSS51 full-length ORF ( AAH94693.1, 1 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MSS51 (MSS51 Mitochondrial Translational Activator) is a Protein Coding gene. |
Molecular Mass : | 77.6 kDa |
AA Sequence : | MAPRSRRRRHKKPPSSVAPIIMAPTTIVTPVPLTPSKPGPSIDTLGFFSLDDNVPGLSQLILQKLNMKSYEEYKLVVDGGTPVSGFGFRCPQEMFQRMEDTFRFCAHCRALPSGLSDSKVLRHCKRCRNVYYCGPECQKSDWPAHRRVCQELRLVAVDRLMEWLLVTGDFVLPSGPWPWPPEAVQDWDSWFSMKGLHLDATLDAVLVSHAVTTLWASVGRPRPDPDVLQGSLKRLLTDVLSRPLTLGLGLRALGIDVRRTGGSTVHVVGASHVETFLTRPGDYDELGYMFPGHLGLRVVMVGVDVATGFSQSTSTSPLEPGTIQLSAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHSSPDLMEAWLPTLLLLRDYKIPTLITVYSHQELVSSLQILVELDTHITAVGSNPFMSLKPEQVYSSPNKQPVYCSAYYIMFLGSSCQLDNRQLEEKVDGGI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MSS51 MSS51 mitochondrial translational activator homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | MSS51 |
Synonyms | ZMYND17; MSS51; MSS51 mitochondrial translational activator homolog (S. cerevisiae) |
Gene ID | 118490 |
mRNA Refseq | NM_001024593 |
Protein Refseq | NP_001019764 |
MIM | 614773 |
UniProt ID | Q4VC12 |
◆ Recombinant Proteins | ||
MSS51-3797R | Recombinant Rat MSS51 Protein | +Inquiry |
MSS51-5669H | Recombinant Human MSS51 Protein, GST-tagged | +Inquiry |
MSS51-6472HF | Recombinant Full Length Human MSS51 Protein, GST-tagged | +Inquiry |
MSS51-3456R | Recombinant Rat MSS51 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSS51-149HCL | Recombinant Human ZMYND17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSS51 Products
Required fields are marked with *
My Review for All MSS51 Products
Required fields are marked with *
0
Inquiry Basket