Recombinant Human MSTN, GST-tagged
Cat.No. : | MSTN-122H |
Product Overview : | Recombinant Human MSTN(1 a.a. - 375 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. This gene is thought to encode a secreted protein which negatively regulates skeletal muscle growth. |
Molecular Mass : | 69.2 kDa |
AA Sequence : | MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKD VIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNK VVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGI EIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIA PKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MSTN myostatin [ Homo sapiens (human) ] |
Official Symbol | MSTN |
Synonyms | MSTN; myostatin; GDF8; MSLHP; growth/differentiation factor 8; GDF-8; growth differentiation factor 8 |
Gene ID | 2660 |
mRNA Refseq | NM_005259 |
Protein Refseq | NP_005250 |
MIM | 601788 |
UniProt ID | O14793 |
Chromosome Location | 2q32.2 |
Pathway | Hypertrophy Model |
Function | cytokine activity; growth factor ; heparin binding; identical protein binding |
◆ Recombinant Proteins | ||
MSTN-15H | Recombinant Human MSTN protein | +Inquiry |
MSTN-1140H | Recombinant Human MSTN Protein, His-tagged | +Inquiry |
Mstn-649M | Active Recombinant Mouse Mstn Protein, Fc Chimera | +Inquiry |
MSTN-3798R | Recombinant Rat MSTN Protein | +Inquiry |
Mstn-1754R | Recombinant Rat Mstn protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSTN-2229MCL | Recombinant Mouse MSTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSTN Products
Required fields are marked with *
My Review for All MSTN Products
Required fields are marked with *
0
Inquiry Basket