Recombinant Human MT1F Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MT1F-2579H |
Product Overview : | MT1F MS Standard C13 and N15-labeled recombinant protein (NP_005940) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
Molecular Mass : | 6.1 kDa |
AA Sequence : | MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MT1F metallothionein 1F [ Homo sapiens (human) ] |
Official Symbol | MT1F |
Synonyms | MT1F; metallothionein 1F; MT1; metallothionein-1F; MT-1F; MT-IF; metallothionein 1F (functional); metallothionein-IF |
Gene ID | 4494 |
mRNA Refseq | NM_005949 |
Protein Refseq | NP_005940 |
MIM | 156352 |
UniProt ID | P04733 |
◆ Recombinant Proteins | ||
MT1F-1066H | Recombinant Human MT1F, GST-tagged | +Inquiry |
MT1F-6992HF | Recombinant Full Length Human MT1F Protein, GST-tagged | +Inquiry |
MT1F-1463H | Recombinant Human MT1F Protein (1-59 aa), His-tagged | +Inquiry |
MT1F-279H | Recombinant Human MT1F | +Inquiry |
MT1F-125H | Recombinant Human MT1F, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT1F-4102HCL | Recombinant Human MT1F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT1F Products
Required fields are marked with *
My Review for All MT1F Products
Required fields are marked with *