Recombinant Human MT1X Protein, His-tagged
| Cat.No. : | MT1X-130H |
| Product Overview : | Recombinant Human MT1X Protein (1-59aa) was expressed in yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-59 a.a. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 7.9kDa |
| AA Sequence : | MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC |
| Purity : | Greater than 90% as determined by SDS-PAGE |
| Storage : | Store at -20 centigrade/-80 centigrade. |
| Gene Name | MT1X metallothionein 1X [ Homo sapiens (human) ] |
| Official Symbol | MT1X |
| Synonyms | MT1; MT-1l |
| Gene ID | 4501 |
| mRNA Refseq | NM_005952.3 |
| Protein Refseq | NP_005943.1 |
| MIM | 156359 |
| UniProt ID | P80297 |
| ◆ Recombinant Proteins | ||
| MT1X-282H | Recombinant Human MT1X | +Inquiry |
| MT1X-1301H | Recombinant Human MT1X Protein (1-59 aa), GST-tagged | +Inquiry |
| MT1X-3534H | Recombinant Human MT1X Protein, His (Fc)-Avi-tagged | +Inquiry |
| MT1X-130H | Recombinant Human MT1X Protein, His-tagged | +Inquiry |
| MT1X-6997HF | Recombinant Full Length Human MT1X Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MT1X-4097HCL | Recombinant Human MT1X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT1X Products
Required fields are marked with *
My Review for All MT1X Products
Required fields are marked with *
