Recombinant Human MT1X Protein, His-tagged
Cat.No. : | MT1X-130H |
Product Overview : | Recombinant Human MT1X Protein (1-59aa) was expressed in yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-59 a.a. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 7.9kDa |
AA Sequence : | MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC |
Purity : | Greater than 90% as determined by SDS-PAGE |
Storage : | Store at -20 centigrade/-80 centigrade. |
Gene Name | MT1X metallothionein 1X [ Homo sapiens (human) ] |
Official Symbol | MT1X |
Synonyms | MT1; MT-1l |
Gene ID | 4501 |
mRNA Refseq | NM_005952.3 |
Protein Refseq | NP_005943.1 |
MIM | 156359 |
UniProt ID | P80297 |
◆ Recombinant Proteins | ||
MT1X-3774H | Recombinant Human MT1X protein, His-tagged | +Inquiry |
MT1X-129H | Recombinant Human MT1X, GST-tagged | +Inquiry |
MT1X-1302H | Recombinant Human MT1X protein, GST-tagged | +Inquiry |
MT1X-1301H | Recombinant Human MT1X Protein (1-59 aa), GST-tagged | +Inquiry |
MT1X-130H | Recombinant Human MT1X Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT1X-4097HCL | Recombinant Human MT1X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT1X Products
Required fields are marked with *
My Review for All MT1X Products
Required fields are marked with *