"MT1X" Related Products

Expand

Recombinant Human MT1X Protein, His-tagged

Cat.No.: MT1X-130H
Product Overview: Recombinant Human MT1X Protein (1-59aa) was expressed in yeast with N-terminal His tag.
Source: Yeast
Species: Human
Tag : His
Form: Tris-based buffer,50% glycerol
Molecular Mass: 7.9kDa
AA Sequence: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC
Purity: Greater than 90% as determined by SDS-PAGE
Storage: Store at -20 centigrade/-80 centigrade.
Gene Name: MT1X metallothionein 1X [ Homo sapiens (human) ]
Official Symbol: MT1X
Synonyms: MT1; MT-1l
Gene ID: 4501
mRNA Refseq: NM_005952.3
Protein Refseq: NP_005943.1
MIM: 156359
UniProt ID: P80297

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.