Recombinant Human MT4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MT4-704H |
Product Overview : | MT4 MS Standard C13 and N15-labeled recombinant protein (NP_116324) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia. |
Molecular Mass : | 6.4 kDa |
AA Sequence : | MDPRECVCMSGGICMCGDNCKCTTCNCKTCRKSCCPCCPPGCAKCARGCICKGGSDKCSCCPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MT4 metallothionein 4 [ Homo sapiens (human) ] |
Official Symbol | MT4 |
Synonyms | MT4; metallothionein 4; MT-4; MTIV; MT-IV; metallothionein-4; metallothionein-IV |
Gene ID | 84560 |
mRNA Refseq | NM_032935 |
Protein Refseq | NP_116324 |
MIM | 606206 |
◆ Recombinant Proteins | ||
MT4-10160M | Recombinant Mouse MT4 Protein | +Inquiry |
MT4-704H | Recombinant Human MT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MT4-783H | Recombinant Human MT4 | +Inquiry |
MT4-7004HF | Recombinant Full Length Human MT4 Protein, GST-tagged | +Inquiry |
MT4-135H | Recombinant Human MT4 Protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT4-4094HCL | Recombinant Human MT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT4 Products
Required fields are marked with *
My Review for All MT4 Products
Required fields are marked with *