Recombinant Human MTA2 protein, GST-tagged

Cat.No. : MTA2-26H
Product Overview : Recombinant Human MTA2(521 a.a. - 620 a.a.) fused with GSTtag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 521-620 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : VKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKAL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name MTA2 metastasis associated 1 family, member 2 [ Homo sapiens ]
Official Symbol MTA2
Synonyms MTA2; metastasis associated 1 family, member 2; metastasis associated gene family, member 2 , MTA1L1; metastasis-associated protein MTA2; MTA1 L1; MTA1-L1 protein; metastasis-associated 1-like 1; metastasis-associated protein 2; metastasis -associated gene 1-like 1; p53 target protein in deacetylase complex; metastasis associated gene family, member 2; PID; MTA1L1; DKFZp686F2281;
Gene ID 9219
mRNA Refseq NM_004739
Protein Refseq NP_004730
MIM 603947
UniProt ID O94776

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTA2 Products

Required fields are marked with *

My Review for All MTA2 Products

Required fields are marked with *

0
cart-icon