Recombinant Human MTA2 protein, GST-tagged
Cat.No. : | MTA2-26H |
Product Overview : | Recombinant Human MTA2(521 a.a. - 620 a.a.) fused with GSTtag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 521-620 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKAL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MTA2 metastasis associated 1 family, member 2 [ Homo sapiens ] |
Official Symbol | MTA2 |
Synonyms | MTA2; metastasis associated 1 family, member 2; metastasis associated gene family, member 2 , MTA1L1; metastasis-associated protein MTA2; MTA1 L1; MTA1-L1 protein; metastasis-associated 1-like 1; metastasis-associated protein 2; metastasis -associated gene 1-like 1; p53 target protein in deacetylase complex; metastasis associated gene family, member 2; PID; MTA1L1; DKFZp686F2281; |
Gene ID | 9219 |
mRNA Refseq | NM_004739 |
Protein Refseq | NP_004730 |
MIM | 603947 |
UniProt ID | O94776 |
◆ Recombinant Proteins | ||
MTA2-10162M | Recombinant Mouse MTA2 Protein | +Inquiry |
MTA2-12725Z | Recombinant Zebrafish MTA2 | +Inquiry |
MTA2-5298H | Recombinant Human MTA2 Protein (Met1-Cys394), N-His tagged | +Inquiry |
MTA2-2710R | Recombinant Rhesus Macaque MTA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTA2-1071H | Recombinant Human MTA2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTA2 Products
Required fields are marked with *
My Review for All MTA2 Products
Required fields are marked with *