Recombinant Human MTA2 protein, GST-tagged
| Cat.No. : | MTA2-26H |
| Product Overview : | Recombinant Human MTA2(521 a.a. - 620 a.a.) fused with GSTtag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 521-620 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | VKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKAL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | MTA2 metastasis associated 1 family, member 2 [ Homo sapiens ] |
| Official Symbol | MTA2 |
| Synonyms | MTA2; metastasis associated 1 family, member 2; metastasis associated gene family, member 2 , MTA1L1; metastasis-associated protein MTA2; MTA1 L1; MTA1-L1 protein; metastasis-associated 1-like 1; metastasis-associated protein 2; metastasis -associated gene 1-like 1; p53 target protein in deacetylase complex; metastasis associated gene family, member 2; PID; MTA1L1; DKFZp686F2281; |
| Gene ID | 9219 |
| mRNA Refseq | NM_004739 |
| Protein Refseq | NP_004730 |
| MIM | 603947 |
| UniProt ID | O94776 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTA2 Products
Required fields are marked with *
My Review for All MTA2 Products
Required fields are marked with *
