Recombinant Human MTBP protein, His-tagged
| Cat.No. : | MTBP-3271H |
| Product Overview : | Recombinant Human MTBP protein(98-253 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 98-253 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QEIHFDTEKDKIEDVLQTNIEECLGAVECFEEEDSNSRESLSLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVGALKHLREWYSAKITIAGNHCEINCQKIAEYLSANVVSLEDLRNVIDSKELWRGKIQIWERKFGFE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa [ Homo sapiens ] |
| Official Symbol | MTBP |
| Synonyms | MTBP; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa; MDM2 (mouse double minute 2) binding protein, 104kD; mdm2-binding protein; hMTBP; MDM2 (mouse double minute 2)-binding protein, 104kD; MDM2BP; |
| Gene ID | 27085 |
| mRNA Refseq | NM_022045 |
| Protein Refseq | NP_071328 |
| MIM | 605927 |
| UniProt ID | Q96DY7 |
| ◆ Recombinant Proteins | ||
| MTBP-3271H | Recombinant Human MTBP protein, His-tagged | +Inquiry |
| MTBP-10176M | Recombinant Mouse MTBP Protein | +Inquiry |
| MTBP-2447B | Recombinant Bacillus subtilis MTBP protein, His-tagged | +Inquiry |
| MTBP-5767M | Recombinant Mouse MTBP Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTBP-4091HCL | Recombinant Human MTBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTBP Products
Required fields are marked with *
My Review for All MTBP Products
Required fields are marked with *
