Recombinant Human MTBP protein, His-tagged
Cat.No. : | MTBP-3271H |
Product Overview : | Recombinant Human MTBP protein(98-253 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 98-253 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QEIHFDTEKDKIEDVLQTNIEECLGAVECFEEEDSNSRESLSLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVGALKHLREWYSAKITIAGNHCEINCQKIAEYLSANVVSLEDLRNVIDSKELWRGKIQIWERKFGFE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MTBP Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa [ Homo sapiens ] |
Official Symbol | MTBP |
Synonyms | MTBP; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa; MDM2 (mouse double minute 2) binding protein, 104kD; mdm2-binding protein; hMTBP; MDM2 (mouse double minute 2)-binding protein, 104kD; MDM2BP; |
Gene ID | 27085 |
mRNA Refseq | NM_022045 |
Protein Refseq | NP_071328 |
MIM | 605927 |
UniProt ID | Q96DY7 |
◆ Recombinant Proteins | ||
MTBP-2447B | Recombinant Bacillus subtilis MTBP protein, His-tagged | +Inquiry |
MTBP-5767M | Recombinant Mouse MTBP Protein, His (Fc)-Avi-tagged | +Inquiry |
MTBP-3271H | Recombinant Human MTBP protein, His-tagged | +Inquiry |
MTBP-10176M | Recombinant Mouse MTBP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTBP-4091HCL | Recombinant Human MTBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTBP Products
Required fields are marked with *
My Review for All MTBP Products
Required fields are marked with *
0
Inquiry Basket