Recombinant Human MTDH Protein, His-tagged

• Cat.No.: MTDH-001H
• Product Overview: Recombinant Human MTDH Protein, His-tagged, expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 167-297 aa
• Tag: His
• Molecular Mass: 15 kDa
• AA Sequence: MKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.7mg/ml by BCA
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol

Gene Information

• Gene Name: MTDH metadherin [ Homo sapiens (human) ]
• Official Symbol: MTDH
• Synonyms: MTDH; metadherin; protein LYRIC; 3D3; AEG 1; LYRIC; 3D3/LYRIC; metastasis adhesion protein; astrocyte elevated gene-1 protein; lysine-rich CEACAM1 co-isolated protein; AEG1; AEG-1; LYRIC/3D3
• Gene ID: 92140
• MIM: 610323
• UniProt ID: Q86UE4