Recombinant Human MTDH Protein, His-tagged
Cat.No. : | MTDH-001H |
Product Overview : | Recombinant Human MTDH Protein, His-tagged, expressed in E. coli. |
Availability | October 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 167-297 aa |
Tag : | His |
Molecular Mass : | 15 kDa |
AA Sequence : | MKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.7mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
Gene Name | MTDH metadherin [ Homo sapiens (human) ] |
Official Symbol | MTDH |
Synonyms | MTDH; metadherin; protein LYRIC; 3D3; AEG 1; LYRIC; 3D3/LYRIC; metastasis adhesion protein; astrocyte elevated gene-1 protein; lysine-rich CEACAM1 co-isolated protein; AEG1; AEG-1; LYRIC/3D3 |
Gene ID | 92140 |
MIM | 610323 |
UniProt ID | Q86UE4 |
◆ Recombinant Proteins | ||
MTDH-10180M | Recombinant Mouse MTDH Protein | +Inquiry |
MTDH-2715R | Recombinant Rhesus Macaque MTDH Protein, His (Fc)-Avi-tagged | +Inquiry |
MTDH-6989H | Recombinant Human MTDH, His & GST tagged | +Inquiry |
MTDH-225H | Recombinant Human MTDH protein, MYC/DDK-tagged | +Inquiry |
MTDH-6487HF | Recombinant Full Length Human MTDH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTDH-507HCL | Recombinant Human MTDH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTDH Products
Required fields are marked with *
My Review for All MTDH Products
Required fields are marked with *