Recombinant Human MTDH Protein, His-tagged
| Cat.No. : | MTDH-001H |
| Product Overview : | Recombinant Human MTDH Protein, His-tagged, expressed in E. coli. |
| Availability | January 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 167-297 aa |
| Tag : | His |
| Molecular Mass : | 15 kDa |
| AA Sequence : | MKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.7mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
| Gene Name | MTDH metadherin [ Homo sapiens (human) ] |
| Official Symbol | MTDH |
| Synonyms | MTDH; metadherin; protein LYRIC; 3D3; AEG 1; LYRIC; 3D3/LYRIC; metastasis adhesion protein; astrocyte elevated gene-1 protein; lysine-rich CEACAM1 co-isolated protein; AEG1; AEG-1; LYRIC/3D3 |
| Gene ID | 92140 |
| MIM | 610323 |
| UniProt ID | Q86UE4 |
| ◆ Recombinant Proteins | ||
| MTDH-001H | Recombinant Human MTDH Protein, His-tagged | +Inquiry |
| MTDH-7845HFL | Recombinant Full Length Human MTDH protein, Flag-tagged | +Inquiry |
| MTDH-10180M | Recombinant Mouse MTDH Protein | +Inquiry |
| MTDH-24H | Recombinant Human MTDH protein, His-tagged | +Inquiry |
| MTDH-2715R | Recombinant Rhesus Macaque MTDH Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTDH-507HCL | Recombinant Human MTDH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTDH Products
Required fields are marked with *
My Review for All MTDH Products
Required fields are marked with *
