Recombinant Human MTFP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MTFP1-5460H |
Product Overview : | MTP18 MS Standard C13 and N15-labeled recombinant protein (NP_057582) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase signaling pathway that plays a role in cell viability and mitochondrial dynamics. |
Molecular Mass : | 18 kDa |
AA Sequence : | MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MTFP1 mitochondrial fission process 1 [ Homo sapiens (human) ] |
Official Symbol | MTFP1 |
Synonyms | MTFP1; mitochondrial fission process 1; MTP18; HSPC242; mitochondrial fission process protein 1; mitochondrial 18 kDa protein; mitochondrial fission protein MTP18; mitochondrial protein 18 kDa |
Gene ID | 51537 |
mRNA Refseq | NM_016498 |
Protein Refseq | NP_057582 |
MIM | 610235 |
UniProt ID | Q9UDX5 |
◆ Recombinant Proteins | ||
RFL152HF | Recombinant Full Length Human Mitochondrial Fission Process Protein 1(Mtfp1) Protein, His-Tagged | +Inquiry |
MTFP1-6557HF | Recombinant Full Length Human MTFP1 Protein, GST-tagged | +Inquiry |
MTFP1-4812H | Recombinant Human MTFP1 protein, GST-tagged | +Inquiry |
MTFP1-5460H | Recombinant Human MTFP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTFP1-2196H | Recombinant Human MTFP1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTFP1-1152HCL | Recombinant Human MTFP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTFP1 Products
Required fields are marked with *
My Review for All MTFP1 Products
Required fields are marked with *