Recombinant Human MTHFS, His-tagged
Cat.No. : | MTHFS-30253TH |
Product Overview : | Recombinant full length Human MTHFS with an N terminal His tag; 223 amino acids with tag, Predicted MWt 25.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 203 amino acids |
Description : | The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 25.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA |
Sequence Similarities : | Belongs to the 5-formyltetrahydrofolate cyclo-ligase family. |
Gene Name | MTHFS 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) [ Homo sapiens ] |
Official Symbol | MTHFS |
Synonyms | MTHFS; 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase); 5-formyltetrahydrofolate cyclo-ligase; HsT19268; |
Gene ID | 10588 |
mRNA Refseq | NM_001199758 |
Protein Refseq | NP_001186687 |
MIM | 604197 |
Uniprot ID | P49914 |
Chromosome Location | 15q24.3 |
Pathway | Metabolic pathways, organism-specific biosystem; One Carbon Metabolism, organism-specific biosystem; One carbon pool by folate, organism-specific biosystem; One carbon pool by folate, conserved biosystem; |
Function | 5-formyltetrahydrofolate cyclo-ligase activity; 5-formyltetrahydrofolate cyclo-ligase activity; ATP binding; folic acid binding; ligase activity; |
◆ Recombinant Proteins | ||
MTHFS-10195M | Recombinant Mouse MTHFS Protein | +Inquiry |
MTHFS-01H | Recombinant Human MTHFS Protein, Myc/DDK-tagged | +Inquiry |
MTHFS-5297R | Recombinant Rabbit MTHFS protein | +Inquiry |
MTHFS-5706H | Recombinant Human MTHFS Protein, GST-tagged | +Inquiry |
MTHFS-2719R | Recombinant Rhesus Macaque MTHFS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFS-4080HCL | Recombinant Human MTHFS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFS Products
Required fields are marked with *
My Review for All MTHFS Products
Required fields are marked with *