Recombinant Human MTHFSD Protein, GST-tagged
| Cat.No. : | MTHFSD-5707H |
| Product Overview : | Human MTHFSD full-length ORF (BAB14383.1, 1 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and nucleotide binding. |
| Molecular Mass : | 67.2 kDa |
| AA Sequence : | MEPRAVGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIKDLDVFARAQEVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQGVRNYSVPIGLDSRVLVDLVVVGSVAASEKGWRIGKGEGYADLEYAMMVSMGAVSKETPVVTIVHDCQVVDIPEELVEEHDITVDYILTPTRVIATGCKRPKPMGITWFKISLEMMEKIPILRSLRAREQQAGKDVTLQGEHQHLPEPGCQQTVPLSVGRRPPDTPGPETNSMEAAPGSPPGEGAPLAADVYVGNLPRDARVSDLKRALRELGSVPLRLTWQGPRRRAFLHYPDSAAASRPSPACRACAWAPTP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTHFSD methenyltetrahydrofolate synthetase domain containing [ Homo sapiens ] |
| Official Symbol | MTHFSD |
| Synonyms | MTHFSD; methenyltetrahydrofolate synthetase domain containing; methenyltetrahydrofolate synthase domain-containing protein; FLJ12998; methenyltetrahydrofolate synthetase domain-containing protein; FLJ13893; MGC138262; MGC138264; MGC177233; |
| Gene ID | 64779 |
| mRNA Refseq | NM_001159377 |
| Protein Refseq | NP_001152849 |
| UniProt ID | Q2M296 |
| ◆ Recombinant Proteins | ||
| MTHFSD-10196M | Recombinant Mouse MTHFSD Protein | +Inquiry |
| MTHFSD-5707H | Recombinant Human MTHFSD Protein, GST-tagged | +Inquiry |
| MTHFSD-6530HF | Recombinant Full Length Human MTHFSD Protein, GST-tagged | +Inquiry |
| MTHFSD-5782M | Recombinant Mouse MTHFSD Protein, His (Fc)-Avi-tagged | +Inquiry |
| MTHFSD-4145Z | Recombinant Zebrafish MTHFSD | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFSD Products
Required fields are marked with *
My Review for All MTHFSD Products
Required fields are marked with *
