Recombinant Human MTHFSD Protein, GST-tagged

Cat.No. : MTHFSD-5707H
Product Overview : Human MTHFSD full-length ORF (BAB14383.1, 1 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and nucleotide binding.
Molecular Mass : 67.2 kDa
AA Sequence : MEPRAVGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIKDLDVFARAQEVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQGVRNYSVPIGLDSRVLVDLVVVGSVAASEKGWRIGKGEGYADLEYAMMVSMGAVSKETPVVTIVHDCQVVDIPEELVEEHDITVDYILTPTRVIATGCKRPKPMGITWFKISLEMMEKIPILRSLRAREQQAGKDVTLQGEHQHLPEPGCQQTVPLSVGRRPPDTPGPETNSMEAAPGSPPGEGAPLAADVYVGNLPRDARVSDLKRALRELGSVPLRLTWQGPRRRAFLHYPDSAAASRPSPACRACAWAPTP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTHFSD methenyltetrahydrofolate synthetase domain containing [ Homo sapiens ]
Official Symbol MTHFSD
Synonyms MTHFSD; methenyltetrahydrofolate synthetase domain containing; methenyltetrahydrofolate synthase domain-containing protein; FLJ12998; methenyltetrahydrofolate synthetase domain-containing protein; FLJ13893; MGC138262; MGC138264; MGC177233;
Gene ID 64779
mRNA Refseq NM_001159377
Protein Refseq NP_001152849
UniProt ID Q2M296

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTHFSD Products

Required fields are marked with *

My Review for All MTHFSD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon