Recombinant Human MTIF3 Protein, GST-tagged

Cat.No. : MTIF3-5708H
Product Overview : Human MTIF3 full-length ORF ( NP_690876.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism in this gene is associated with the onset of Parkinson's disease. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Oct 2009]
Molecular Mass : 58.1 kDa
AA Sequence : MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTIF3 mitochondrial translational initiation factor 3 [ Homo sapiens ]
Official Symbol MTIF3
Synonyms MTIF3; mitochondrial translational initiation factor 3; translation initiation factor IF-3, mitochondrial; IF 3mt; IF3(mt); IF-3(Mt); IF3mt; FLJ33676;
Gene ID 219402
mRNA Refseq NM_001166261
Protein Refseq NP_001159733
UniProt ID Q9H2K0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTIF3 Products

Required fields are marked with *

My Review for All MTIF3 Products

Required fields are marked with *

0
cart-icon
0
compare icon