Recombinant Human MTIF3 Protein, GST-tagged
Cat.No. : | MTIF3-5708H |
Product Overview : | Human MTIF3 full-length ORF ( NP_690876.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism in this gene is associated with the onset of Parkinson's disease. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 58.1 kDa |
AA Sequence : | MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTIF3 mitochondrial translational initiation factor 3 [ Homo sapiens ] |
Official Symbol | MTIF3 |
Synonyms | MTIF3; mitochondrial translational initiation factor 3; translation initiation factor IF-3, mitochondrial; IF 3mt; IF3(mt); IF-3(Mt); IF3mt; FLJ33676; |
Gene ID | 219402 |
mRNA Refseq | NM_001166261 |
Protein Refseq | NP_001159733 |
UniProt ID | Q9H2K0 |
◆ Recombinant Proteins | ||
Mtif3-4213M | Recombinant Mouse Mtif3 Protein, Myc/DDK-tagged | +Inquiry |
MTIF3-6531HF | Recombinant Full Length Human MTIF3 Protein, GST-tagged | +Inquiry |
MTIF3-6127H | Recombinant Human MTIF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTIF3-5708H | Recombinant Human MTIF3 Protein, GST-tagged | +Inquiry |
MTIF3-5158C | Recombinant Chicken MTIF3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTIF3-4079HCL | Recombinant Human MTIF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTIF3 Products
Required fields are marked with *
My Review for All MTIF3 Products
Required fields are marked with *
0
Inquiry Basket