Recombinant Human MTIF3 Protein (1-278 aa), GST-tagged

Cat.No. : MTIF3-2150H
Product Overview : Recombinant Human MTIF3 Protein (1-278 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-278 aa
Description : IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 55.2 kDa
AA Sequence : TAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name MTIF3 mitochondrial translational initiation factor 3 [ Homo sapiens ]
Official Symbol MTIF3
Synonyms MTIF3; IF 3mt; IF3(mt); IF-3(Mt); IF3mt; FLJ33676;
Gene ID 219402
mRNA Refseq NM_001166261
Protein Refseq NP_001159733
UniProt ID Q9H2K0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTIF3 Products

Required fields are marked with *

My Review for All MTIF3 Products

Required fields are marked with *

0
cart-icon