Recombinant Human MTIF3 Protein (1-278 aa), GST-tagged
Cat.No. : | MTIF3-2150H |
Product Overview : | Recombinant Human MTIF3 Protein (1-278 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-278 aa |
Description : | IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 55.2 kDa |
AA Sequence : | TAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | MTIF3 mitochondrial translational initiation factor 3 [ Homo sapiens ] |
Official Symbol | MTIF3 |
Synonyms | MTIF3; IF 3mt; IF3(mt); IF-3(Mt); IF3mt; FLJ33676; |
Gene ID | 219402 |
mRNA Refseq | NM_001166261 |
Protein Refseq | NP_001159733 |
UniProt ID | Q9H2K0 |
◆ Recombinant Proteins | ||
MTIF3-5708H | Recombinant Human MTIF3 Protein, GST-tagged | +Inquiry |
MTIF3-5158C | Recombinant Chicken MTIF3 | +Inquiry |
Mtif3-4213M | Recombinant Mouse Mtif3 Protein, Myc/DDK-tagged | +Inquiry |
MTIF3-6531HF | Recombinant Full Length Human MTIF3 Protein, GST-tagged | +Inquiry |
MTIF3-5159C | Recombinant Chicken MTIF3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTIF3-4079HCL | Recombinant Human MTIF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTIF3 Products
Required fields are marked with *
My Review for All MTIF3 Products
Required fields are marked with *
0
Inquiry Basket