Recombinant Human MTMR1 Protein, GST-tagged
| Cat.No. : | MTMR1-5711H |
| Product Overview : | Human MTMR1 full-length ORF ( AAH11250, 1 a.a. - 38 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq |
| Molecular Mass : | 29.92 kDa |
| AA Sequence : | MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTMR1 myotubularin related protein 1 [ Homo sapiens ] |
| Official Symbol | MTMR1 |
| Synonyms | MTMR1; myotubularin related protein 1; myotubularin-related protein 1; |
| Gene ID | 8776 |
| mRNA Refseq | NM_003828 |
| Protein Refseq | NP_003819 |
| MIM | 300171 |
| UniProt ID | Q13613 |
| ◆ Recombinant Proteins | ||
| MTMR1-6079H | Recombinant Human MTMR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Mtmr1-4214M | Recombinant Mouse Mtmr1 Protein, Myc/DDK-tagged | +Inquiry |
| MTMR1-5784M | Recombinant Mouse MTMR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MTMR1-5711H | Recombinant Human MTMR1 Protein, GST-tagged | +Inquiry |
| MTMR1-2192H | Recombinant Human MTMR1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTMR1-1147HCL | Recombinant Human MTMR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTMR1 Products
Required fields are marked with *
My Review for All MTMR1 Products
Required fields are marked with *
