Recombinant Human MTMR3 Protein, GST-tagged

• Cat.No.: MTMR3-5720H
• Product Overview: Human MTMR3 partial ORF ( NP_066576.1, 579 a.a. - 674 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-associate and also form heteromers with another myotubularin related protein. The protein binds to phosphoinositide lipids through the PH-GRAM domain, and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3,5)-biphosphate in vitro. The encoded protein has been observed to have a perinuclear, possibly membrane-bound, distribution in cells, but it has also been found free in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 36.3 kDa
• AA Sequence: CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTMR3 myotubularin related protein 3 [ Homo sapiens ]
• Official Symbol: MTMR3
• Synonyms: MTMR3; myotubularin related protein 3; myotubularin-related protein 3; FYVE DSP1; KIAA0371; ZFYVE10; zinc finger, FYVE domain containing 10; zinc finger FYVE domain-containing protein 10; FYVE domain-containing dual specificity protein phosphatase 1; FYVE (Fab1 YGLO23 Vsp27 EEA1 domain) dual-specificity protein phosphatase; FYVE-DSP1; FLJ32333
• Gene ID: 8897
• mRNA Refseq: NM_021090
• Protein Refseq: NP_066576
• MIM: 603558
• UniProt ID: Q13615