Recombinant Human MTOR

Cat.No. : MTOR-30254TH
Product Overview : Recombinant fragment of Human mTOR with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
Availability December 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in numerous tissues, with highest levels in testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
Sequence Similarities : Belongs to the PI3/PI4-kinase family.Contains 1 FAT domain.Contains 1 FATC domain.Contains 7 HEAT repeats.Contains 1 PI3K/PI4K domain.
Gene Name MTOR mechanistic target of rapamycin (serine/threonine kinase) [ Homo sapiens ]
Official Symbol MTOR
Synonyms MTOR; mechanistic target of rapamycin (serine/threonine kinase); FK506 binding protein 12 rapamycin associated protein 1 , FRAP, FRAP1, FRAP2; serine/threonine-protein kinase mTOR; dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1); FK506
Gene ID 2475
mRNA Refseq NM_004958
Protein Refseq NP_004949
MIM 601231
Uniprot ID P42345
Chromosome Location 1p36
Pathway AMPK signaling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem;
Function ATP binding; RNA polymerase III type 1 promoter DNA binding; RNA polymerase III type 2 promoter DNA binding; RNA polymerase III type 3 promoter DNA binding; TFIIIC-class transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTOR Products

Required fields are marked with *

My Review for All MTOR Products

Required fields are marked with *

0
cart-icon
0
compare icon