Recombinant Human MTOR
| Cat.No. : | MTOR-30254TH |
| Product Overview : | Recombinant fragment of Human mTOR with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Expressed in numerous tissues, with highest levels in testis. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW |
| Sequence Similarities : | Belongs to the PI3/PI4-kinase family.Contains 1 FAT domain.Contains 1 FATC domain.Contains 7 HEAT repeats.Contains 1 PI3K/PI4K domain. |
| Gene Name | MTOR mechanistic target of rapamycin (serine/threonine kinase) [ Homo sapiens ] |
| Official Symbol | MTOR |
| Synonyms | MTOR; mechanistic target of rapamycin (serine/threonine kinase); FK506 binding protein 12 rapamycin associated protein 1 , FRAP, FRAP1, FRAP2; serine/threonine-protein kinase mTOR; dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1); FK506 |
| Gene ID | 2475 |
| mRNA Refseq | NM_004958 |
| Protein Refseq | NP_004949 |
| MIM | 601231 |
| Uniprot ID | P42345 |
| Chromosome Location | 1p36 |
| Pathway | AMPK signaling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; |
| Function | ATP binding; RNA polymerase III type 1 promoter DNA binding; RNA polymerase III type 2 promoter DNA binding; RNA polymerase III type 3 promoter DNA binding; TFIIIC-class transcription factor binding; |
| ◆ Recombinant Proteins | ||
| MTOR-156H | Recombinant Human MTOR, MYC/DDK-tagged | +Inquiry |
| Mtor-1798M | Recombinant Mouse Mtor Protein, His-tagged | +Inquiry |
| MTOR-42H | Active Recombinant Human MTOR/RPTOR/MLST8 protein, FLAG/His-tagged | +Inquiry |
| Mtor-25M | Recombinant Mouse Mtor protein, His-tagged | +Inquiry |
| MTOR-3815R | Recombinant Rat MTOR Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTOR-374HKCL | Human MTOR Knockdown Cell Lysate | +Inquiry |
| MTOR-4068HCL | Recombinant Human MTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTOR Products
Required fields are marked with *
My Review for All MTOR Products
Required fields are marked with *
