Recombinant Human MTOR
Cat.No. : | MTOR-30254TH |
Product Overview : | Recombinant fragment of Human mTOR with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in numerous tissues, with highest levels in testis. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW |
Sequence Similarities : | Belongs to the PI3/PI4-kinase family.Contains 1 FAT domain.Contains 1 FATC domain.Contains 7 HEAT repeats.Contains 1 PI3K/PI4K domain. |
Gene Name | MTOR mechanistic target of rapamycin (serine/threonine kinase) [ Homo sapiens ] |
Official Symbol | MTOR |
Synonyms | MTOR; mechanistic target of rapamycin (serine/threonine kinase); FK506 binding protein 12 rapamycin associated protein 1 , FRAP, FRAP1, FRAP2; serine/threonine-protein kinase mTOR; dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1); FK506 |
Gene ID | 2475 |
mRNA Refseq | NM_004958 |
Protein Refseq | NP_004949 |
MIM | 601231 |
Uniprot ID | P42345 |
Chromosome Location | 1p36 |
Pathway | AMPK signaling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; |
Function | ATP binding; RNA polymerase III type 1 promoter DNA binding; RNA polymerase III type 2 promoter DNA binding; RNA polymerase III type 3 promoter DNA binding; TFIIIC-class transcription factor binding; |
◆ Recombinant Proteins | ||
Mtor-25M | Recombinant Mouse Mtor protein, His-tagged | +Inquiry |
MTOR-4396H | Recombinant Human MTOR protein, His&Myc-tagged | +Inquiry |
MTOR-21H | Recombinant Human MTOR Protein, His-tagged | +Inquiry |
MTOR-10215M | Recombinant Mouse MTOR Protein | +Inquiry |
MTOR-30254TH | Recombinant Human MTOR | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTOR-4068HCL | Recombinant Human MTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTOR Products
Required fields are marked with *
My Review for All MTOR Products
Required fields are marked with *
0
Inquiry Basket