Recombinant Human MTOR

• Cat.No.: MTOR-30254TH
• Product Overview: Recombinant fragment of Human mTOR with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed in numerous tissues, with highest levels in testis.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
• Sequence Similarities: Belongs to the PI3/PI4-kinase family.Contains 1 FAT domain.Contains 1 FATC domain.Contains 7 HEAT repeats.Contains 1 PI3K/PI4K domain.

Gene Information

• Gene Name: MTOR mechanistic target of rapamycin (serine/threonine kinase) [ Homo sapiens ]
• Official Symbol: MTOR
• Synonyms: MTOR; mechanistic target of rapamycin (serine/threonine kinase); FK506 binding protein 12 rapamycin associated protein 1 , FRAP, FRAP1, FRAP2; serine/threonine-protein kinase mTOR; dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1); FK506
• Gene ID: 2475
• mRNA Refseq: NM_004958
• Protein Refseq: NP_004949
• MIM: 601231
• Uniprot ID: P42345
• Chromosome Location: 1p36
• Pathway: AMPK signaling, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem
• Function: ATP binding; RNA polymerase III type 1 promoter DNA binding; RNA polymerase III type 2 promoter DNA binding; RNA polymerase III type 3 promoter DNA binding; TFIIIC-class transcription factor binding