Recombinant Human MTRR Protein, GST-tagged

• Cat.No.: MTRR-5735H
• Product Overview: Human MTRR partial ORF ( NP_002445, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: MRRFLLLYATQQGQAKAIAEEMCEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTRR 5-methyltetrahydrofolate-homocysteine methyltransferase reductase [ Homo sapiens ]
• Official Symbol: MTRR
• Synonyms: MTRR; 5-methyltetrahydrofolate-homocysteine methyltransferase reductase; methionine synthase reductase; cblE; methionine synthase reductase, mitochondrial; [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing); MSR; MGC129643
• Gene ID: 4552
• mRNA Refseq: NM_002454
• Protein Refseq: NP_002445
• MIM: 602568
• UniProt ID: Q9UBK8