Recombinant Human MTRR Protein, GST-tagged

Cat.No. : MTRR-5735H
Product Overview : Human MTRR partial ORF ( NP_002445, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : MRRFLLLYATQQGQAKAIAEEMCEQAVVHGFSADLHCISESDKYDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTRR 5-methyltetrahydrofolate-homocysteine methyltransferase reductase [ Homo sapiens ]
Official Symbol MTRR
Synonyms MTRR; 5-methyltetrahydrofolate-homocysteine methyltransferase reductase; methionine synthase reductase; cblE; methionine synthase reductase, mitochondrial; [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing); MSR; MGC129643;
Gene ID 4552
mRNA Refseq NM_002454
Protein Refseq NP_002445
MIM 602568
UniProt ID Q9UBK8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTRR Products

Required fields are marked with *

My Review for All MTRR Products

Required fields are marked with *

0
cart-icon
0
compare icon