Recombinant Human MTSS1 protein, GST-tagged
| Cat.No. : | MTSS1-301382H |
| Product Overview : | Recombinant Human MTSS1 (345-446 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Pro345-Gly446 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | PGVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQG |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | MTSS1 metastasis suppressor 1 [ Homo sapiens ] |
| Official Symbol | MTSS1 |
| Synonyms | MTSS1; metastasis suppressor 1; metastasis suppressor protein 1; KIAA0429; MIM; MIMA; MIMB; metastasis suppressor YGL-1; missing in metastasis protein; FLJ44694; DKFZp781P2223; |
| Gene ID | 9788 |
| mRNA Refseq | NM_014751 |
| Protein Refseq | NP_055566 |
| MIM | 608486 |
| UniProt ID | O43312 |
| ◆ Recombinant Proteins | ||
| MTSS1-5736H | Recombinant Human MTSS1 Protein, GST-tagged | +Inquiry |
| MTSS1-6564HF | Recombinant Full Length Human MTSS1 Protein, GST-tagged | +Inquiry |
| MTSS1-301382H | Recombinant Human MTSS1 protein, GST-tagged | +Inquiry |
| MTSS1-6990H | Recombinant Human MTSS1 protein, His&MBP-tagged | +Inquiry |
| MTSS1-2642C | Recombinant Chicken MTSS1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTSS1 Products
Required fields are marked with *
My Review for All MTSS1 Products
Required fields are marked with *



