Recombinant Human MTSS1 protein, GST-tagged

Cat.No. : MTSS1-301382H
Product Overview : Recombinant Human MTSS1 (345-446 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Pro345-Gly446
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : PGVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name MTSS1 metastasis suppressor 1 [ Homo sapiens ]
Official Symbol MTSS1
Synonyms MTSS1; metastasis suppressor 1; metastasis suppressor protein 1; KIAA0429; MIM; MIMA; MIMB; metastasis suppressor YGL-1; missing in metastasis protein; FLJ44694; DKFZp781P2223;
Gene ID 9788
mRNA Refseq NM_014751
Protein Refseq NP_055566
MIM 608486
UniProt ID O43312

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTSS1 Products

Required fields are marked with *

My Review for All MTSS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon