Recombinant Human MTTP Protein, GST-tagged
| Cat.No. : | MTTP-5739H |
| Product Overview : | Human MTTP full-length ORF ( AAH62696.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
| Availability | October 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. [provided by RefSeq |
| Molecular Mass : | 43.3 kDa |
| AA Sequence : | MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHGKVKGRLDSTTFSPTSYFSSLQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTTP microsomal triglyceride transfer protein [ Homo sapiens ] |
| Official Symbol | MTTP |
| Synonyms | MTTP; microsomal triglyceride transfer protein; microsomal triglyceride transfer protein (large polypeptide, 88kD) , microsomal triglyceride transfer protein (large polypeptide, 88kDa) , MTP; microsomal triglyceride transfer protein large subunit; ABL; microsomal triglyceride transfer protein (large polypeptide, 88kDa); MTP; MGC149819; MGC149820; |
| Gene ID | 4547 |
| mRNA Refseq | NM_000253 |
| Protein Refseq | NP_000244 |
| MIM | 157147 |
| UniProt ID | P55157 |
| ◆ Recombinant Proteins | ||
| MTTP-5739H | Recombinant Human MTTP Protein, GST-tagged | +Inquiry |
| MTTP-6566HF | Recombinant Full Length Human MTTP Protein, GST-tagged | +Inquiry |
| MTTP-3761C | Recombinant Chicken MTTP | +Inquiry |
| MTTP-271H | Recombinant Human MTTP | +Inquiry |
| Mttp-7973M | Recombinant Mouse Mttp protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTTP-4064HCL | Recombinant Human MTTP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTTP Products
Required fields are marked with *
My Review for All MTTP Products
Required fields are marked with *
