Recombinant Human MTTP Protein, GST-tagged
Cat.No. : | MTTP-5739H |
Product Overview : | Human MTTP full-length ORF ( AAH62696.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. [provided by RefSeq |
Molecular Mass : | 43.3 kDa |
AA Sequence : | MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHGKVKGRLDSTTFSPTSYFSSLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTTP microsomal triglyceride transfer protein [ Homo sapiens ] |
Official Symbol | MTTP |
Synonyms | MTTP; microsomal triglyceride transfer protein; microsomal triglyceride transfer protein (large polypeptide, 88kD) , microsomal triglyceride transfer protein (large polypeptide, 88kDa) , MTP; microsomal triglyceride transfer protein large subunit; ABL; microsomal triglyceride transfer protein (large polypeptide, 88kDa); MTP; MGC149819; MGC149820; |
Gene ID | 4547 |
mRNA Refseq | NM_000253 |
Protein Refseq | NP_000244 |
MIM | 157147 |
UniProt ID | P55157 |
◆ Recombinant Proteins | ||
MTTP-6566HF | Recombinant Full Length Human MTTP Protein, GST-tagged | +Inquiry |
MTTP-5739H | Recombinant Human MTTP Protein, GST-tagged | +Inquiry |
MTTP-3761C | Recombinant Chicken MTTP | +Inquiry |
Mttp-7973M | Recombinant Mouse Mttp protein, His & T7-tagged | +Inquiry |
MTTP-3541H | Recombinant Human MTTP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTTP-4064HCL | Recombinant Human MTTP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTTP Products
Required fields are marked with *
My Review for All MTTP Products
Required fields are marked with *
0
Inquiry Basket