Recombinant Human MTTP Protein, GST-tagged

Cat.No. : MTTP-5739H
Product Overview : Human MTTP full-length ORF ( AAH62696.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
Availability December 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. [provided by RefSeq
Molecular Mass : 43.3 kDa
AA Sequence : MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHGKVKGRLDSTTFSPTSYFSSLQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTTP microsomal triglyceride transfer protein [ Homo sapiens ]
Official Symbol MTTP
Synonyms MTTP; microsomal triglyceride transfer protein; microsomal triglyceride transfer protein (large polypeptide, 88kD) , microsomal triglyceride transfer protein (large polypeptide, 88kDa) , MTP; microsomal triglyceride transfer protein large subunit; ABL; microsomal triglyceride transfer protein (large polypeptide, 88kDa); MTP; MGC149819; MGC149820;
Gene ID 4547
mRNA Refseq NM_000253
Protein Refseq NP_000244
MIM 157147
UniProt ID P55157

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTTP Products

Required fields are marked with *

My Review for All MTTP Products

Required fields are marked with *

0
cart-icon
0
compare icon