Recombinant Human MUC1 Protein, GST-tagged

Cat.No. : MUC1-5745H
Product Overview : Human MUC1 partial ORF ( NP_877418.1, 315 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined. [provided by RefSeq
Molecular Mass : 37.4 kDa
AA Sequence : NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDMETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MUC1 mucin 1, cell surface associated [ Homo sapiens ]
Official Symbol MUC1
Synonyms MUC1; mucin 1, cell surface associated; mucin 1, transmembrane , PUM; mucin-1; CD227; PEM; episialin; DF3 antigen; H23 antigen; krebs von den Lungen-6; mucin 1, transmembrane; tumor-associated mucin; carcinoma-associated mucin; polymorphic epithelial mucin; peanut-reactive urinary mucin; tumor associated epithelial mucin; breast carcinoma-associated antigen DF3; tumor-associated epithelial membrane antigen; EMA; PUM; KL-6; MAM6; PEMT; H23AG; MUC-1; MUC-1/X; MUC1/ZD; MUC-1/SEC;
Gene ID 4582
mRNA Refseq NM_001018016
Protein Refseq NP_001018016
MIM 158340
UniProt ID P15941

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC1 Products

Required fields are marked with *

My Review for All MUC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon