Recombinant Human MUC1 Protein, GST-tagged
Cat.No. : | MUC1-5745H |
Product Overview : | Human MUC1 partial ORF ( NP_877418.1, 315 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined. [provided by RefSeq |
Molecular Mass : | 37.4 kDa |
AA Sequence : | NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDMETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MUC1 mucin 1, cell surface associated [ Homo sapiens ] |
Official Symbol | MUC1 |
Synonyms | MUC1; mucin 1, cell surface associated; mucin 1, transmembrane , PUM; mucin-1; CD227; PEM; episialin; DF3 antigen; H23 antigen; krebs von den Lungen-6; mucin 1, transmembrane; tumor-associated mucin; carcinoma-associated mucin; polymorphic epithelial mucin; peanut-reactive urinary mucin; tumor associated epithelial mucin; breast carcinoma-associated antigen DF3; tumor-associated epithelial membrane antigen; EMA; PUM; KL-6; MAM6; PEMT; H23AG; MUC-1; MUC-1/X; MUC1/ZD; MUC-1/SEC; |
Gene ID | 4582 |
mRNA Refseq | NM_001018016 |
Protein Refseq | NP_001018016 |
MIM | 158340 |
UniProt ID | P15941 |
◆ Recombinant Proteins | ||
MUC1-342HAF555 | Recombinant Human MUC1 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
MUC1-448HAF488 | Recombinant Human MUC1 Protein, Alexa Fluor 488 conjugated | +Inquiry |
MUC1-0500H | Recombinant Human MUC1 protein, Fc-tagged | +Inquiry |
MUC1-4622H | Recombinant Human MUC1 Protein (Ala927-Gly1158), C-His tagged | +Inquiry |
MUC1-0498C | Recombinant Cynomolgus MUC1 protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
MUC1-376H | Active Native Human MUC1 | +Inquiry |
MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MUC1-1980HCL | Recombinant Human MUC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC1 Products
Required fields are marked with *
My Review for All MUC1 Products
Required fields are marked with *
0
Inquiry Basket