Recombinant Human MUC15, His-tagged
Cat.No. : | MUC15-149H |
Product Overview : | Recombinant Human Mucin-15/MUC15 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys24-Thr236) of Human MUC15 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-236 a.a. |
Description : | Mucin-15 is a single-pass type I membrane protein member of the Mucin family. Mucins are a family of high molecular weight, heavily glycosylated proteins (glycoconjugates) produced by epithelial tissues in most metazoans. A key characteristic of Mucins is their ability to form gels. Therefore they are a key component in most gel-like secretions, serving functions from lubrication to cell signalling to forming chemical barriers. Mucin-15 is expressed in many tissues. Mucin-15 is highly glycosylated (N- and O-linked carbohydrates). Mucin-15 may play a role in the cell adhesion to the extracellular matrix. |
AA Sequence : | KENQDINTTQNIAEVFKTMENKPISLESEANLNSDKENITTSNLKASHSPPLNLPNNSHGITDFS SNSSAEHSLGSLKPTSTISTSPPLIHSFVSKVPWNAPIADEDLLPISAHPNATPALSSENFTWSL VNDTVKTPDNSSITVSILSSEPTSPSVTPLIVEPSGWLTTNSDSFTGFIPYQEKTTLQPTLKFTN NSKLFPNTSDPQKENRNTVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | MUC15 mucin 15, cell surface associated [ Homo sapiens ] |
Official Symbol | MUC15 |
Synonyms | MUC15; mucin 15, cell surface associated; mucin-15; PAS3; MUC-15; PASIII; |
Gene ID | 143662 |
mRNA Refseq | NM_001135091 |
Protein Refseq | NP_001128563 |
MIM | 608566 |
UniProt ID | Q8N387 |
Chromosome Location | 11p14.3 |
Pathway | Metabolism of proteins, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Termination of O-glycan biosynthesis, organism-specific biosystem; |
◆ Recombinant Proteins | ||
MUC15-163H | Recombinant Human MUC15 Protein, HIS-tagged | +Inquiry |
MUC15-1106H | Recombinant Human MUC15, His-tagged | +Inquiry |
MUC15-149H | Recombinant Human MUC15, His-tagged | +Inquiry |
MUC15-4033H | Recombinant Human MUC15 Protein (Lys24-Thr236), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MUC15-4060HCL | Recombinant Human MUC15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC15 Products
Required fields are marked with *
My Review for All MUC15 Products
Required fields are marked with *