Recombinant Human MUC15, His-tagged

Cat.No. : MUC15-149H
Product Overview : Recombinant Human Mucin-15/MUC15 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys24-Thr236) of Human MUC15 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 24-236 a.a.
Description : Mucin-15 is a single-pass type I membrane protein member of the Mucin family. Mucins are a family of high molecular weight, heavily glycosylated proteins (glycoconjugates) produced by epithelial tissues in most metazoans. A key characteristic of Mucins is their ability to form gels. Therefore they are a key component in most gel-like secretions, serving functions from lubrication to cell signalling to forming chemical barriers. Mucin-15 is expressed in many tissues. Mucin-15 is highly glycosylated (N- and O-linked carbohydrates). Mucin-15 may play a role in the cell adhesion to the extracellular matrix.
AA Sequence : KENQDINTTQNIAEVFKTMENKPISLESEANLNSDKENITTSNLKASHSPPLNLPNNSHGITDFS SNSSAEHSLGSLKPTSTISTSPPLIHSFVSKVPWNAPIADEDLLPISAHPNATPALSSENFTWSL VNDTVKTPDNSSITVSILSSEPTSPSVTPLIVEPSGWLTTNSDSFTGFIPYQEKTTLQPTLKFTN NSKLFPNTSDPQKENRNTVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name MUC15 mucin 15, cell surface associated [ Homo sapiens ]
Official Symbol MUC15
Synonyms MUC15; mucin 15, cell surface associated; mucin-15; PAS3; MUC-15; PASIII;
Gene ID 143662
mRNA Refseq NM_001135091
Protein Refseq NP_001128563
MIM 608566
UniProt ID Q8N387
Chromosome Location 11p14.3
Pathway Metabolism of proteins, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Termination of O-glycan biosynthesis, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC15 Products

Required fields are marked with *

My Review for All MUC15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon