Recombinant Human MUC16 Protein, GST-tagged
| Cat.No. : | MUC16-5748H |
| Product Overview : | Human MUC16 partial ORF ( AAK74120.3, 1321 a.a. - 1415 a.a.) recombinant protein with GST-tag at N-terminal. |
| Availability | August 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that is a member of the mucin family. Mucins are high molecular weight, O-glycosylated proteins that play an important role in forming a protective mucous barrier, and are found on the apical surfaces of the epithelia. The encoded protein is a membrane-tethered mucin that contains an extracellular domain at its amino terminus, a large tandem repeat domain, and a transmembrane domain with a short cytoplasmic domain. The amino terminus is highly glycosylated, while the repeat region contains 156 amino acid repeats unit that are rich in serines, threonines, and prolines. Interspersed within the repeats are Sea urchin sperm protein Enterokinase and Agrin (SEA) modules, leucine-rich repeats and ankyrin (ANK) repeats. These regions together form the ectodomain, and there is a potential cleavage site found near an SEA module close to the transmembrane domain. This protein is thought to play a role in forming a barrier, protecting epithelial cells from pathogens. Products of this gene have been used as a marker for different cancers, with higher expression levels associated with poorer outcomes. [provided by RefSeq, May 2017] |
| Molecular Mass : | 36.19 kDa |
| AA Sequence : | VSRTEVMPSSRTSIPGPAQSTMSLDISDEVVTRLSTSPIMTESAEITITTQTGYSLATSQVTLPLGTSMTFLSGTHSTMSQGLSHSEMTNLMSRG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MUC16 mucin 16, cell surface associated [ Homo sapiens ] |
| Official Symbol | MUC16 |
| Synonyms | MUC16; mucin 16, cell surface associated; mucin-16; CA125; FLJ14303; CA-125; MUC-16; CA125 ovarian cancer antigen; ovarian carcinoma antigen CA125; ovarian cancer-related tumor marker CA125; |
| Gene ID | 94025 |
| mRNA Refseq | NM_024690 |
| Protein Refseq | NP_078966 |
| MIM | 606154 |
| UniProt ID | Q8WXI7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC16 Products
Required fields are marked with *
My Review for All MUC16 Products
Required fields are marked with *



