Recombinant Human MUC17 protein, His-tagged

• Cat.No.: MUC17-0483H
• Product Overview: Recombinant Human MUC17 protein(Q685J3)(4131-4390aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 4131-4390 a.a.
• Tag: C-His
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody, the EC50 is 0.9057-1.259 ng/mL.
• Molecular Mass: 32.0kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL

Gene Information

• Gene Name: MUC17 mucin 17, cell surface associated [ Homo sapiens ]
• Official Symbol: MUC17
• Synonyms: MUC17; mucin 17, cell surface associated; mucin-17; MUC-3; MUC-17; membrane mucin MUC17; secreted mucin MUC17; small intestinal mucin-3; small intestinal mucin MUC3; MUC3
• Gene ID: 140453
• mRNA Refseq: NM_001040105
• Protein Refseq: NP_001035194
• MIM: 608424
• UniProt ID: Q685J3