Species : |
Human |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
4131-4390 a.a. |
Tag : |
C-His |
Form : |
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : |
Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody, the EC50 is 0.9057-1.259 ng/mL. |
Molecular Mass : |
32.0kDa |
Endotoxin : |
Less than 1.0 EU/ug as determined by LAL method. |
Purity : |
Greater than 95% as determined by SDS-PAGE. |
Storage : |
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : |
RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL |