Recombinant Human MUC17 protein, His-tagged
Cat.No. : | MUC17-0483H |
Product Overview : | Recombinant Human MUC17 protein(Q685J3)(4131-4390aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 4131-4390 a.a. |
Tag : | C-His |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody, the EC50 is 0.9057-1.259 ng/mL. |
Molecular Mass : | 32.0kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL |
Gene Name | MUC17 mucin 17, cell surface associated [ Homo sapiens ] |
Official Symbol | MUC17 |
Synonyms | MUC17; mucin 17, cell surface associated; mucin-17; MUC-3; MUC-17; membrane mucin MUC17; secreted mucin MUC17; small intestinal mucin-3; small intestinal mucin MUC3; MUC3; |
Gene ID | 140453 |
mRNA Refseq | NM_001040105 |
Protein Refseq | NP_001035194 |
MIM | 608424 |
UniProt ID | Q685J3 |
◆ Recombinant Proteins | ||
MUC17-0483H | Recombinant Human MUC17 protein, His-tagged | +Inquiry |
MUC17-4020H | Recombinant Human MUC17 Protein (Ala4069-Gly4393), N-His tagged | +Inquiry |
MUC17-607H | Recombinant Human MUC17 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MUC17 Products
Required fields are marked with *
My Review for All MUC17 Products
Required fields are marked with *
0
Inquiry Basket