Recombinant Human MUC2 Protein (36-240 aa), His-tagged
Cat.No. : | MUC2-1466H |
Product Overview : | Recombinant Human MUC2 Protein (36-240 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 36-240 aa |
Description : | Coats the epithelia of the intestines, airways, and other mucus mbrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.8 kDa |
AA Sequence : | VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | MUC2 mucin 2, oligomeric mucus/gel-forming [ Homo sapiens ] |
Official Symbol | MUC2 |
Synonyms | MUC2; mucin-2; MLP; SMUC; MUC-2; |
Gene ID | 4583 |
mRNA Refseq | NM_002457 |
Protein Refseq | NP_002448 |
MIM | 158370 |
UniProt ID | Q02817 |
◆ Recombinant Proteins | ||
MUC2-3254H | Recombinant Human MUC2 protein, His-tagged | +Inquiry |
Muc2-690M | Recombinant Mouse Muc2 protein, His-tagged | +Inquiry |
Muc2-1803R | Recombinant Rat Muc2 Protein, His-tagged | +Inquiry |
MUC2-672H | Recombinant Human MUC2 Protein (36-240 aa), His-SUMO-tagged | +Inquiry |
Muc2-691M | Recombinant Mouse Muc2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC2 Products
Required fields are marked with *
My Review for All MUC2 Products
Required fields are marked with *
0
Inquiry Basket