Recombinant Human MUC2 Protein (36-240 aa), His-tagged

Cat.No. : MUC2-1466H
Product Overview : Recombinant Human MUC2 Protein (36-240 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 36-240 aa
Description : Coats the epithelia of the intestines, airways, and other mucus mbrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.8 kDa
AA Sequence : VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name MUC2 mucin 2, oligomeric mucus/gel-forming [ Homo sapiens ]
Official Symbol MUC2
Synonyms MUC2; mucin-2; MLP; SMUC; MUC-2;
Gene ID 4583
mRNA Refseq NM_002457
Protein Refseq NP_002448
MIM 158370
UniProt ID Q02817

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC2 Products

Required fields are marked with *

My Review for All MUC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon