Recombinant Human MUC5B, GST-tagged
| Cat.No. : | MUC5B-1030H |
| Product Overview : | Recombinant Human MUC5B(4186 a.a. - 4295 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the mucin family of proteins, which are highly glycosylated macromolecular components of mucus secretions. This family member is the major gel-forming mucin in mucus. It is a major contributor to the lubricating and viscoelastic properties of whole saliva, normal lung mucus and cervical mucus. This gene has been found to be up-regulated in some human diseases, including sinus mucosa of chronic rhinosinusitis (CRS), CRS with nasal polyposis, chronic obstructive pulmonary disease (COPD) and H. pylori-associated gastric disease, and it may be involved in the pathogenesis of these diseases. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILH TYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MUC5B mucin 5B, oligomeric mucus/gel-forming [ Homo sapiens (human) ] |
| Official Symbol | MUC5B |
| Synonyms | MUC5B; mucin 5B, oligomeric mucus/gel-forming; MG1; MUC5; MUC9; MUC-5B; mucin-5B; cervical mucin MUC5B; high molecular weight salivary mucin MG1; mucin 5, subtype B, tracheobronchial; sublingual gland mucin |
| Gene ID | 727897 |
| mRNA Refseq | NM_002458 |
| Protein Refseq | NP_002449 |
| MIM | 600770 |
| UniProt ID | Q9HC84 |
| Chromosome Location | 11p15.5 |
| Pathway | Metabolism of proteins; O-linked glycosylation; Post-translational protein modification; Salivary secretion |
| Function | protein binding |
| ◆ Recombinant Proteins | ||
| Muc5b-785M | Recombinant Mouse Muc5b protein, His-tagged | +Inquiry |
| Muc5b-788R | Recombinant Rat Muc5b protein, His & GST-tagged | +Inquiry |
| MUC5B-5149H | Recombinant Human MUC5B Protein (Ser5657-Ala5756), N-GST tagged | +Inquiry |
| Muc5b-787R | Recombinant Rat Muc5b protein, His & GST-tagged | +Inquiry |
| MUC5B-783C | Recombinant Cattle MUC5B protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC5B Products
Required fields are marked with *
My Review for All MUC5B Products
Required fields are marked with *
