Recombinant Human MUC5B, GST-tagged

• Cat.No.: MUC5B-1030H
• Product Overview: Recombinant Human MUC5B(4186 a.a. - 4295 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the mucin family of proteins, which are highly glycosylated macromolecular components of mucus secretions. This family member is the major gel-forming mucin in mucus. It is a major contributor to the lubricating and viscoelastic properties of whole saliva, normal lung mucus and cervical mucus. This gene has been found to be up-regulated in some human diseases, including sinus mucosa of chronic rhinosinusitis (CRS), CRS with nasal polyposis, chronic obstructive pulmonary disease (COPD) and H. pylori-associated gastric disease, and it may be involved in the pathogenesis of these diseases.
• Molecular Mass: 37.84 kDa
• AA Sequence: CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILH TYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MUC5B mucin 5B, oligomeric mucus/gel-forming [ Homo sapiens (human) ]
• Official Symbol: MUC5B
• Synonyms: MUC5B; mucin 5B, oligomeric mucus/gel-forming; MG1; MUC5; MUC9; MUC-5B; mucin-5B; cervical mucin MUC5B; high molecular weight salivary mucin MG1; mucin 5, subtype B, tracheobronchial; sublingual gland mucin
• Gene ID: 727897
• mRNA Refseq: NM_002458
• Protein Refseq: NP_002449
• MIM: 600770
• UniProt ID: Q9HC84
• Chromosome Location: 11p15.5
• Pathway: Metabolism of proteins; O-linked glycosylation; Post-translational protein modification; Salivary secretion
• Function: protein binding