Recombinant Human MUCL1 protein, GST-tagged
| Cat.No. : | MUCL1-1110H |
| Product Overview : | Recombinant Human MUCL1 protein(21-90 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 21-90 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | NPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | MUCL1 |
| Synonyms | SBEM |
| Gene ID | 118430 |
| mRNA Refseq | NM_058173.2 |
| Protein Refseq | NP_477521.1 |
| MIM | 610857 |
| UniProt ID | Q96DR8 |
| ◆ Recombinant Proteins | ||
| MUCL1-1017H | Recombinant Human MUCL1 | +Inquiry |
| MUCL1-1870H | Recombinant Human MUCL1 protein, His & GST-tagged | +Inquiry |
| MUCL1-657H | Recombinant Human mucin-like 1, His-tagged | +Inquiry |
| MUCL1-1110H | Recombinant Human MUCL1 protein, GST-tagged | +Inquiry |
| MUCL1-3545H | Recombinant Human MUCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MUCL1-4059HCL | Recombinant Human MUCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUCL1 Products
Required fields are marked with *
My Review for All MUCL1 Products
Required fields are marked with *
