Recombinant Human MUM1 protein, GST-tagged

Cat.No. : MUM1-1112H
Product Overview : Recombinant Human MUM1 protein(1-152 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability September 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-152 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRWLQTFLSSSQYVTCVETYLEDEGQLDLVVKYLQGVYQEVGAKVLQRTNGDRIRFILDVLLPEAIICAISAVDEVDYKTAEEKYIKGPSLSYREKEIFDNQLLEERNRRRR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name MUM1 melanoma associated antigen (mutated) 1 [ Homo sapiens ]
Official Symbol MUM1
Synonyms MUM1; melanoma associated antigen (mutated) 1; PWWP domain-containing protein MUM1; MUM 1; protein expandere; melanoma ubiquitous mutated protein; mutated melanoma-associated antigen 1; MUM-1; EXPAND1; HSPC211; FLJ14868; FLJ22283; MGC131891; MGC163315;
Gene ID 84939
mRNA Refseq NM_032853
Protein Refseq NP_116242
UniProt ID Q2TAK8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUM1 Products

Required fields are marked with *

My Review for All MUM1 Products

Required fields are marked with *

0
cart-icon