Recombinant Human MUM1 protein, GST-tagged
Cat.No. : | MUM1-1112H |
Product Overview : | Recombinant Human MUM1 protein(1-152 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | July 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-152 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRWLQTFLSSSQYVTCVETYLEDEGQLDLVVKYLQGVYQEVGAKVLQRTNGDRIRFILDVLLPEAIICAISAVDEVDYKTAEEKYIKGPSLSYREKEIFDNQLLEERNRRRR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MUM1 melanoma associated antigen (mutated) 1 [ Homo sapiens ] |
Official Symbol | MUM1 |
Synonyms | MUM1; melanoma associated antigen (mutated) 1; PWWP domain-containing protein MUM1; MUM 1; protein expandere; melanoma ubiquitous mutated protein; mutated melanoma-associated antigen 1; MUM-1; EXPAND1; HSPC211; FLJ14868; FLJ22283; MGC131891; MGC163315; |
Gene ID | 84939 |
mRNA Refseq | NM_032853 |
Protein Refseq | NP_116242 |
UniProt ID | Q2TAK8 |
◆ Recombinant Proteins | ||
MUM1-5444C | Recombinant Chicken MUM1 | +Inquiry |
MUM1-3191H | Recombinant Human MUM1 protein, His-tagged | +Inquiry |
MUM1-1112H | Recombinant Human MUM1 protein, GST-tagged | +Inquiry |
MUM1-10238M | Recombinant Mouse MUM1 Protein | +Inquiry |
MUM1-5807M | Recombinant Mouse MUM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MUM1-1156HCL | Recombinant Human MUM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUM1 Products
Required fields are marked with *
My Review for All MUM1 Products
Required fields are marked with *