Recombinant Human MYBL1

Cat.No. : MYBL1-29831TH
Product Overview : Recombinant fragment of Human v-Myb with N terminal proprietary tag; Predicted MW 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Expressed in a variety of lymphoid and solid tumor lines cultured in vitro.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KSLVLDNWEKEESGTQLLTEDISDMQSENRFTTSLLMIPL LEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVK LEKNLQSNCEWETVVYGKTEDQLIMTEQAR
Sequence Similarities : Contains 3 HTH myb-type DNA-binding domains.
Gene Name MYBL1 v-myb myeloblastosis viral oncogene homolog (avian)-like 1 [ Homo sapiens ]
Official Symbol MYBL1
Synonyms MYBL1; v-myb myeloblastosis viral oncogene homolog (avian)-like 1; v myb avian myeloblastosis viral oncogene homolog like 1; myb-related protein A; A myb; AMYB;
Gene ID 4603
mRNA Refseq NM_001080416
Protein Refseq NP_001073885
MIM 159405
Uniprot ID P10243
Chromosome Location 8q22
Pathway HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; IL4-mediated signaling events, organism-specific biosystem;
Function DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYBL1 Products

Required fields are marked with *

My Review for All MYBL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon