Recombinant Human MYBL1
Cat.No. : | MYBL1-29831TH |
Product Overview : | Recombinant fragment of Human v-Myb with N terminal proprietary tag; Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Expressed in a variety of lymphoid and solid tumor lines cultured in vitro. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KSLVLDNWEKEESGTQLLTEDISDMQSENRFTTSLLMIPL LEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVK LEKNLQSNCEWETVVYGKTEDQLIMTEQAR |
Sequence Similarities : | Contains 3 HTH myb-type DNA-binding domains. |
Gene Name | MYBL1 v-myb myeloblastosis viral oncogene homolog (avian)-like 1 [ Homo sapiens ] |
Official Symbol | MYBL1 |
Synonyms | MYBL1; v-myb myeloblastosis viral oncogene homolog (avian)-like 1; v myb avian myeloblastosis viral oncogene homolog like 1; myb-related protein A; A myb; AMYB; |
Gene ID | 4603 |
mRNA Refseq | NM_001080416 |
Protein Refseq | NP_001073885 |
MIM | 159405 |
Uniprot ID | P10243 |
Chromosome Location | 8q22 |
Pathway | HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; IL4-mediated signaling events, organism-specific biosystem; |
Function | DNA binding; |
◆ Recombinant Proteins | ||
MYBL1-10281M | Recombinant Mouse MYBL1 Protein | +Inquiry |
MYBL1-29831TH | Recombinant Human MYBL1 | +Inquiry |
MYBL1-6785C | Recombinant Chicken MYBL1 | +Inquiry |
MYBL1-5780H | Recombinant Human MYBL1 Protein, GST-tagged | +Inquiry |
MYBL1-5828M | Recombinant Mouse MYBL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYBL1 Products
Required fields are marked with *
My Review for All MYBL1 Products
Required fields are marked with *