Recombinant Human MYBL1
Cat.No. : | MYBL1-29831TH |
Product Overview : | Recombinant fragment of Human v-Myb with N terminal proprietary tag; Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in a variety of lymphoid and solid tumor lines cultured in vitro. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KSLVLDNWEKEESGTQLLTEDISDMQSENRFTTSLLMIPL LEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVK LEKNLQSNCEWETVVYGKTEDQLIMTEQAR |
Sequence Similarities : | Contains 3 HTH myb-type DNA-binding domains. |
Gene Name : | MYBL1 v-myb myeloblastosis viral oncogene homolog (avian)-like 1 [ Homo sapiens ] |
Official Symbol : | MYBL1 |
Synonyms : | MYBL1; v-myb myeloblastosis viral oncogene homolog (avian)-like 1; v myb avian myeloblastosis viral oncogene homolog like 1; myb-related protein A; A myb; AMYB; |
Gene ID : | 4603 |
mRNA Refseq : | NM_001080416 |
Protein Refseq : | NP_001073885 |
MIM : | 159405 |
Uniprot ID : | P10243 |
Chromosome Location : | 8q22 |
Pathway : | HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; IL4-mediated signaling events, organism-specific biosystem; |
Function : | DNA binding; |
Products Types
◆ Recombinant Protein | ||
MYBL1-5780H | Recombinant Human MYBL1 Protein, GST-tagged | +Inquiry |
MYBL1-5828M | Recombinant Mouse MYBL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYBL1-10281M | Recombinant Mouse MYBL1 Protein | +Inquiry |
MYBL1-6785C | Recombinant Chicken MYBL1 | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket