Recombinant Human MYBPC1 Protein, GST-tagged
| Cat.No. : | MYBPC1-5784H |
| Product Overview : | Human MYBPC1 partial ORF ( NP_996556, 506 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the myosin-binding protein C family. Myosin-binding protein C family members are myosin-associated proteins found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. The encoded protein is the slow skeletal muscle isoform of myosin-binding protein C and plays an important role in muscle contraction by recruiting muscle-type creatine kinase to myosin filaments. Mutations in this gene are associated with distal arthrogryposis type I. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | DAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYBPC1 myosin binding protein C, slow type [ Homo sapiens ] |
| Official Symbol | MYBPC1 |
| Synonyms | MYBPC1; myosin binding protein C, slow type; myosin-binding protein C, slow-type; slow MyBP-C; skeletal muscle C-protein; C-protein, skeletal muscle slow isoform; MYBPCC; MYBPCS; |
| Gene ID | 4604 |
| mRNA Refseq | NM_001254718 |
| Protein Refseq | NP_001241647 |
| MIM | 160794 |
| UniProt ID | Q00872 |
| ◆ Recombinant Proteins | ||
| MYBPC1-3494R | Recombinant Rat MYBPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYBPC1-521H | Recombinant Human MYBPC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MYBPC1-3835R | Recombinant Rat MYBPC1 Protein | +Inquiry |
| Mybpc1-414M | Recombinant Mouse Mybpc1 Protein, MYC/DDK-tagged | +Inquiry |
| MYBPC1-1714Z | Recombinant Zebrafish MYBPC1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYBPC1-4042HCL | Recombinant Human MYBPC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYBPC1 Products
Required fields are marked with *
My Review for All MYBPC1 Products
Required fields are marked with *
