Recombinant Human MYBPC1 Protein, GST-tagged
Cat.No. : | MYBPC1-5784H |
Product Overview : | Human MYBPC1 partial ORF ( NP_996556, 506 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the myosin-binding protein C family. Myosin-binding protein C family members are myosin-associated proteins found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. The encoded protein is the slow skeletal muscle isoform of myosin-binding protein C and plays an important role in muscle contraction by recruiting muscle-type creatine kinase to myosin filaments. Mutations in this gene are associated with distal arthrogryposis type I. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | DAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYBPC1 myosin binding protein C, slow type [ Homo sapiens ] |
Official Symbol | MYBPC1 |
Synonyms | MYBPC1; myosin binding protein C, slow type; myosin-binding protein C, slow-type; slow MyBP-C; skeletal muscle C-protein; C-protein, skeletal muscle slow isoform; MYBPCC; MYBPCS; |
Gene ID | 4604 |
mRNA Refseq | NM_001254718 |
Protein Refseq | NP_001241647 |
MIM | 160794 |
UniProt ID | Q00872 |
◆ Recombinant Proteins | ||
MYBPC1-3494R | Recombinant Rat MYBPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mybpc1-8015M | Recombinant Mouse Mybpc1 protein, His & T7-tagged | +Inquiry |
MYBPC1-521H | Recombinant Human MYBPC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYBPC1-3835R | Recombinant Rat MYBPC1 Protein | +Inquiry |
MYBPC1-1714Z | Recombinant Zebrafish MYBPC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYBPC1-4042HCL | Recombinant Human MYBPC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYBPC1 Products
Required fields are marked with *
My Review for All MYBPC1 Products
Required fields are marked with *