Recombinant Human MYBPC1 Protein, GST-tagged

• Cat.No.: MYBPC1-5784H
• Product Overview: Human MYBPC1 partial ORF ( NP_996556, 506 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the myosin-binding protein C family. Myosin-binding protein C family members are myosin-associated proteins found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. The encoded protein is the slow skeletal muscle isoform of myosin-binding protein C and plays an important role in muscle contraction by recruiting muscle-type creatine kinase to myosin filaments. Mutations in this gene are associated with distal arthrogryposis type I. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
• Molecular Mass: 36.52 kDa
• AA Sequence: DAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYBPC1 myosin binding protein C, slow type [ Homo sapiens ]
• Official Symbol: MYBPC1
• Synonyms: MYBPC1; myosin binding protein C, slow type; myosin-binding protein C, slow-type; slow MyBP-C; skeletal muscle C-protein; C-protein, skeletal muscle slow isoform; MYBPCC; MYBPCS
• Gene ID: 4604
• mRNA Refseq: NM_001254718
• Protein Refseq: NP_001241647
• MIM: 160794
• UniProt ID: Q00872