Recombinant Human MYBPC1 Protein, GST-tagged

Cat.No. : MYBPC1-5784H
Product Overview : Human MYBPC1 partial ORF ( NP_996556, 506 a.a. - 603 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the myosin-binding protein C family. Myosin-binding protein C family members are myosin-associated proteins found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. The encoded protein is the slow skeletal muscle isoform of myosin-binding protein C and plays an important role in muscle contraction by recruiting muscle-type creatine kinase to myosin filaments. Mutations in this gene are associated with distal arthrogryposis type I. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
Molecular Mass : 36.52 kDa
AA Sequence : DAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYBPC1 myosin binding protein C, slow type [ Homo sapiens ]
Official Symbol MYBPC1
Synonyms MYBPC1; myosin binding protein C, slow type; myosin-binding protein C, slow-type; slow MyBP-C; skeletal muscle C-protein; C-protein, skeletal muscle slow isoform; MYBPCC; MYBPCS;
Gene ID 4604
mRNA Refseq NM_001254718
Protein Refseq NP_001241647
MIM 160794
UniProt ID Q00872

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYBPC1 Products

Required fields are marked with *

My Review for All MYBPC1 Products

Required fields are marked with *

0
cart-icon