Recombinant Human MYBPC3 Protein, His-Tagged
Cat.No. : | MYBPC3-01H |
Product Overview : | Recombinant human MYBPC3 protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3 is expressed exclusively in heart muscle and is a key regulator of cardiac contraction. Mutations in this gene are a frequent cause of familial hypertrophic cardiomyopathy. |
Applications : | Western blotting, ELISA |
AA Sequence : | MKHHHHHHASMPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAF |
Endotoxin : | < 1.0 EU/μg |
Purity : | Purity as determined by densitometric image analysis: > 95% |
Storage Buffer : | Filtered (0.4 μm) and lyophilized in 20 mM Tris buffer, 50 mM NaCl, pH 7.5 |
Reconstitution : | Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture. |
Storage : | Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week. |
Notes : | This product is intended for research use only. |
Molecular Mass : | 29.6 kDa (calculated) |
Identity : | LC-MS/MS |
Gene Name | MYBPC3 myosin binding protein C3 [ Homo sapiens (human) ] |
Official Symbol | MYBPC3 |
Synonyms | Cardiac MyBP-C, C-protein, cardiac muscle isoform, MYBPC3, Myosin Binding Protein-C3, cMyC |
Gene ID | 4607 |
mRNA Refseq | NM_000256.3 |
Protein Refseq | NP_000247.2 |
UniProt ID | Q14896 |
MIM | 600958 |
◆ Recombinant Proteins | ||
MYBPC3-19H | Recombinant Human MYBPC3 protein, MYC/DDK-tagged | +Inquiry |
MYBPC3-3495R | Recombinant Rat MYBPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYBPC3-01H | Recombinant Human MYBPC3 Protein, His-Tagged | +Inquiry |
MYBPC3-6673C | Recombinant Chicken MYBPC3 | +Inquiry |
MYBPC3-8230H | Recombinant Human MYBPC3 protein, His & GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYBPC3 Products
Required fields are marked with *
My Review for All MYBPC3 Products
Required fields are marked with *
0
Inquiry Basket