Recombinant Human MYBPC3 protein, GST-tagged
Cat.No. : | MYBPC3-3565H |
Product Overview : | Recombinant Human MYBPC3 protein(1-328 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-328 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | MYBPC3 |
Synonyms | MYBPC3; myosin binding protein C, cardiac; CMH4, myosin binding protein C, cardiac; myosin-binding protein C, cardiac-type; FHC; MYBP C; C-protein, cardiac muscle isoform; myosin-binding protein C, cardiac; CMH4; MYBP-C; DKFZp779E1762; |
Gene ID | 4607 |
mRNA Refseq | NM_000256 |
Protein Refseq | NP_000247 |
MIM | 600958 |
UniProt ID | Q14896 |
◆ Recombinant Proteins | ||
MYBPC3-9131HFL | Recombinant Full Length Human MYBPC3 protein, Flag-tagged | +Inquiry |
MYBPC3-1467R | Recombinant Rat MYBPC3 Protein (645-864 aa), His-tagged | +Inquiry |
MYBPC3-4636H | Recombinant Human MYBPC3 Protein (Met1-Ala328), N-His tagged | +Inquiry |
MYBPC3-501H | Recombinant Human MYBPC3 | +Inquiry |
MYBPC3-3565H | Recombinant Human MYBPC3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYBPC3 Products
Required fields are marked with *
My Review for All MYBPC3 Products
Required fields are marked with *