Recombinant Human MYC Protein, Biotin labeled

• Cat.No.: MYC-05H
• Product Overview: Biotin labeled recombinant Human MYC Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 350-434 aa
• Conjugation/Label: Biotin
• Description: This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.
• AASequence: KCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQL
• Molecular Mass: ~13 kDa
• Optimal pH: 0
• Isoelectric Point: 0
• Purity: > 95% by SDS-PAGE
• Storage: Store it under sterile conditions at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Storage Buffer: PBS, pH7.4 with 20% Glycerol
• Concentration: 0.684 mg/mL

Gene Information

• Gene Name: MYC MYC proto-oncogene, bHLH transcription factor [ Homo sapiens (human) ]
• Official Symbol: MYC
• Synonyms: MYC; v-myc myelocytomatosis viral oncogene homolog (avian); v myc avian myelocytomatosis viral oncogene homolog; myc proto-oncogene protein; bHLHe39; c Myc; proto-oncogene c-Myc; transcription factor p64; class E basic helix-loop-helix protein 39; avian myelocytomatosis viral oncogene homolog; v-myc avian myelocytomatosis viral oncogene homolog; myc-related translation/localization regulatory factor; MRTL; c-Myc
• Gene ID: 4609
• mRNA Refseq: NM_002467
• Protein Refseq: NP_002458
• MIM: 190080
• UniProt ID: P01106