Recombinant Human MYC Protein, Biotin labeled

Cat.No. : MYC-05H
Product Overview : Biotin labeled recombinant Human MYC Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 350-434 aa
Conjugation/Label : Biotin
Description : This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini.
AASequence : KCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQL
Molecular Mass : ~13 kDa
Optimal pH : 0
Isoelectric Point : 0
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -80 centigrade. Avoid repeated freeze-thaw cycles.
Storage Buffer : PBS, pH7.4 with 20% Glycerol
Concentration : 0.684 mg/mL
Gene Name MYC MYC proto-oncogene, bHLH transcription factor [ Homo sapiens (human) ]
Official Symbol MYC
Synonyms MYC; v-myc myelocytomatosis viral oncogene homolog (avian); v myc avian myelocytomatosis viral oncogene homolog; myc proto-oncogene protein; bHLHe39; c Myc; proto-oncogene c-Myc; transcription factor p64; class E basic helix-loop-helix protein 39; avian myelocytomatosis viral oncogene homolog; v-myc avian myelocytomatosis viral oncogene homolog; myc-related translation/localization regulatory factor; MRTL; c-Myc
Gene ID 4609
mRNA Refseq NM_002467
Protein Refseq NP_002458
MIM 190080
UniProt ID P01106

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYC Products

Required fields are marked with *

My Review for All MYC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon