Recombinant Human MYC Protein, Biotin labeled
Cat.No. : | MYC-05H |
Product Overview : | Biotin labeled recombinant Human MYC Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 350-434 aa |
Conjugation/Label : | Biotin |
Description : | This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. |
AASequence : | KCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQL |
Molecular Mass : | ~13 kDa |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | PBS, pH7.4 with 20% Glycerol |
Concentration : | 0.684 mg/mL |
Conjugation : | Biotin |
Gene Name | MYC MYC proto-oncogene, bHLH transcription factor [ Homo sapiens (human) ] |
Official Symbol | MYC |
Synonyms | MYC; v-myc myelocytomatosis viral oncogene homolog (avian); v myc avian myelocytomatosis viral oncogene homolog; myc proto-oncogene protein; bHLHe39; c Myc; proto-oncogene c-Myc; transcription factor p64; class E basic helix-loop-helix protein 39; avian myelocytomatosis viral oncogene homolog; v-myc avian myelocytomatosis viral oncogene homolog; myc-related translation/localization regulatory factor; MRTL; c-Myc |
Gene ID | 4609 |
mRNA Refseq | NM_002467 |
Protein Refseq | NP_002458 |
MIM | 190080 |
UniProt ID | P01106 |
◆ Recombinant Proteins | ||
Myc-71M | Recombinant Mouse Myc, Arg-tagged | +Inquiry |
MYC-5372C | Recombinant Cat MYC protein, Avi-tagged, Biotinylated | +Inquiry |
MYC-32H | Recombinant Active Human c-Myc Protein (1-454) | +Inquiry |
Myc-6774M | Recombinant Mouse Myc protein, His & GST-tagged | +Inquiry |
MYC-3258H | Recombinant Human MYC protein, His-GST-tagged | +Inquiry |
◆ Native Proteins | ||
MYC-05H | Recombinant Human MYC Protein, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYC-4039HCL | Recombinant Human MYC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYC Products
Required fields are marked with *
My Review for All MYC Products
Required fields are marked with *