Recombinant Human MYCLP1 Protein, GST-tagged

Cat.No. : MYCLP1-5792H
Product Overview : Human MYCL2 partial ORF ( AAB97938.1, 258 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MYCLP1 (MYCL Pseudogene 1) is a Pseudogene.
Molecular Mass : 36.85 kDa
AA Sequence : AAQSCQPKPIHYDTENWTKKKYHSYLERKRRNDQRSRFLALRDEVPALASCSRVSKVMILVKATEYLHELAEAEERMATEKRQLECQRRQLQKRIEYLSSY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYCLP1 MYCL pseudogene 1 [ Homo sapiens (human) ]
Official Symbol MYCLP1
Synonyms MYCLP1; MYCL pseudogene 1; MYCL2; L-MYC2; MYCL1P1; bHLHe38; MYCL-related processed; v-myc avian myelocytomatosis viral oncogene homolog 1 pseudogene 1; v-myc avian myelocytomatosis viral oncogene homolog 2; v-myc myelocytomatosis viral oncogene homolog 1 pseudogene 1; v-myc myelocytomatosis viral oncogene homolog 2
Gene ID 4611
UniProt ID P12525

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYCLP1 Products

Required fields are marked with *

My Review for All MYCLP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon