Recombinant Human MYCLP1 Protein, GST-tagged

• Cat.No.: MYCLP1-5792H
• Product Overview: Human MYCL2 partial ORF ( AAB97938.1, 258 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MYCLP1 (MYCL Pseudogene 1) is a Pseudogene.
• Molecular Mass: 36.85 kDa
• AA Sequence: AAQSCQPKPIHYDTENWTKKKYHSYLERKRRNDQRSRFLALRDEVPALASCSRVSKVMILVKATEYLHELAEAEERMATEKRQLECQRRQLQKRIEYLSSY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYCLP1 MYCL pseudogene 1 [ Homo sapiens (human) ]
• Official Symbol: MYCLP1
• Synonyms: MYCLP1; MYCL pseudogene 1; MYCL2; L-MYC2; MYCL1P1; bHLHe38; MYCL-related processed; v-myc avian myelocytomatosis viral oncogene homolog 1 pseudogene 1; v-myc avian myelocytomatosis viral oncogene homolog 2; v-myc myelocytomatosis viral oncogene homolog 1 pseudogene 1; v-myc myelocytomatosis viral oncogene homolog 2
• Gene ID: 4611
• UniProt ID: P12525