Recombinant Human MYCLP1 Protein, GST-tagged
| Cat.No. : | MYCLP1-5792H |
| Product Overview : | Human MYCL2 partial ORF ( AAB97938.1, 258 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MYCLP1 (MYCL Pseudogene 1) is a Pseudogene. |
| Molecular Mass : | 36.85 kDa |
| AA Sequence : | AAQSCQPKPIHYDTENWTKKKYHSYLERKRRNDQRSRFLALRDEVPALASCSRVSKVMILVKATEYLHELAEAEERMATEKRQLECQRRQLQKRIEYLSSY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYCLP1 MYCL pseudogene 1 [ Homo sapiens (human) ] |
| Official Symbol | MYCLP1 |
| Synonyms | MYCLP1; MYCL pseudogene 1; MYCL2; L-MYC2; MYCL1P1; bHLHe38; MYCL-related processed; v-myc avian myelocytomatosis viral oncogene homolog 1 pseudogene 1; v-myc avian myelocytomatosis viral oncogene homolog 2; v-myc myelocytomatosis viral oncogene homolog 1 pseudogene 1; v-myc myelocytomatosis viral oncogene homolog 2 |
| Gene ID | 4611 |
| UniProt ID | P12525 |
| ◆ Recombinant Proteins | ||
| MYCLP1-5792H | Recombinant Human MYCLP1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYCLP1 Products
Required fields are marked with *
My Review for All MYCLP1 Products
Required fields are marked with *
