Recombinant Human MYCN
Cat.No. : | MYCN-30409TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-100 of Human n-Myc with a proprietary tag; Predicted MWt 36.63 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name | MYCN v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [ Homo sapiens ] |
Official Symbol | MYCN |
Synonyms | MYCN; v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian); NMYC, v myc avian myelocytomatosis viral related oncogene, neuroblastoma derived; N-myc proto-oncogene protein; bHLHe37; N myc; |
Gene ID | 4613 |
mRNA Refseq | NM_005378 |
Protein Refseq | NP_005369 |
MIM | 164840 |
Uniprot ID | P04198 |
Chromosome Location | 2p24.3 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
MYCN-7006HF | Recombinant Full Length Human MYCN Protein, GST-tagged | +Inquiry |
MYCN-3841R | Recombinant Rat MYCN Protein | +Inquiry |
MYCN-5832M | Recombinant Mouse MYCN Protein, His (Fc)-Avi-tagged | +Inquiry |
MYCN-35H | Recombinant Human MYCN Protein (Full length), N-GST-tagged | +Inquiry |
MYCN-3128H | Recombinant Human MYCN protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYCN-4036HCL | Recombinant Human MYCN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYCN Products
Required fields are marked with *
My Review for All MYCN Products
Required fields are marked with *
0
Inquiry Basket