Recombinant Human MYEF2 Protein (372-576 aa), His-SUMO-tagged
Cat.No. : | MYEF2-675H |
Product Overview : | Recombinant Human MYEF2 Protein (372-576 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transport. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 372-576 aa |
Description : | Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 elent 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 37.3 kDa |
AA Sequence : | GGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | MYEF2 myelin expression factor 2 [ Homo sapiens ] |
Official Symbol | MYEF2 |
Synonyms | MEF-2; MST156; MSTP156; HsT18564; |
Gene ID | 50804 |
mRNA Refseq | NM_016132.3 |
Protein Refseq | NP_057216.2 |
UniProt ID | Q9P2K5 |
◆ Recombinant Proteins | ||
MYEF2-1129H | Recombinant Human MYEF2, GST-tagged | +Inquiry |
MYEF2-1644H | Recombinant Human MYEF2 | +Inquiry |
MYEF2-5798H | Recombinant Human MYEF2 Protein, GST-tagged | +Inquiry |
MYEF2-2919R | Recombinant Rhesus monkey MYEF2 Protein, His-tagged | +Inquiry |
MYEF2-1998C | Recombinant Chicken MYEF2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYEF2 Products
Required fields are marked with *
My Review for All MYEF2 Products
Required fields are marked with *