Recombinant Human MYH16 Protein, GST-tagged

• Cat.No.: MYH16-5803H
• Product Overview: Human MYH16 partial ORF ( BAB15219.1, 396 a.a. - 495 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The MYH16 gene, encoding a sarcomeric myosin heavy chain expressed in nonhuman primate masticatory muscles, is inactivated in humans. Stedman et al. (2004) [PubMed 15042088] hypothesized that the decrement in masticatory muscle size caused by the inactivation of MYH16 removed an evolutionary constraint on encephalization in early man.
• Molecular Mass: 36.74 kDa
• AA Sequence: ASMETIQKSKMNAEAHVRKLEDSLSEANAKVAELERNQAEINAIRTRLQAENSELSREYEESQSRLNQILRIKTSLTSQVDDYKRQLDEESKSRSTAVVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYH16 myosin heavy chain 16 pseudogene [ Homo sapiens (human) ]
• Official Symbol: MYH16
• Synonyms: MYH16; myosin heavy chain 16 pseudogene; MYH5; MHC20; MYH16P; myosin heavy polypeptide 5; myosin, heavy chain 16; myosin, heavy polypeptide 16; sarcomeric myosin
• Gene ID: 84176
• MIM: 608580
• UniProt ID: Q9H6N6