Recombinant Human MYH3
Cat.No. : | MYH3-29215TH |
Product Overview : | Recombinant fragment corresponding to amino acids 2-100 of Human heavy chain Myosin with an N terminal proprietary tag; Predicted MWt 36.52 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. Mutations in this gene have been associated with two congenital contracture (arthrogryposis) syndromes, Freeman-Sheldon syndrome and Sheldon-Hall syndrome. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP |
Sequence Similarities : | Contains 1 IQ domain.Contains 1 myosin head-like domain. |
Gene Name | MYH3 myosin, heavy chain 3, skeletal muscle, embryonic [ Homo sapiens ] |
Official Symbol | MYH3 |
Synonyms | MYH3; myosin, heavy chain 3, skeletal muscle, embryonic; myosin, heavy polypeptide 3, skeletal muscle, embryonic; myosin-3; HEMHC; muscle embryonic myosin heavy chain 3; MYHC EMB; MYHSE1; myosin; skeletal; heavy chain; embryonic 1; SMHCE; |
Gene ID | 4621 |
mRNA Refseq | NM_002470 |
Protein Refseq | NP_002461 |
MIM | 160720 |
Uniprot ID | P11055 |
Chromosome Location | 17pter-p11 |
Pathway | Muscle contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Tight junction, organism-specific biosystem; Tight junction, conserved biosystem; |
Function | ATP binding; actin binding; calmodulin binding; microfilament motor activity; nucleotide binding; |
◆ Recombinant Proteins | ||
MYH3-8016H | Recombinant Human MYH3 protein, His-tagged | +Inquiry |
MYH3-905HFL | Recombinant Full Length Human MYH3 Protein, C-Flag-tagged | +Inquiry |
MYH3-5804H | Recombinant Human MYH3 Protein, GST-tagged | +Inquiry |
MYH3-10304M | Recombinant Mouse MYH3 Protein | +Inquiry |
MYH3-5839M | Recombinant Mouse MYH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYH3-4032HCL | Recombinant Human MYH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYH3 Products
Required fields are marked with *
My Review for All MYH3 Products
Required fields are marked with *
0
Inquiry Basket