Recombinant Human MYH3 Protein, GST-tagged
Cat.No. : | MYH3-5804H |
Product Overview : | Human MYH3 partial ORF ( NP_002461.1, 2 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. Mutations in this gene have been associated with two congenital contracture (arthrogryposis) syndromes, Freeman-Sheldon syndrome and Sheldon-Hall syndrome. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYH3 myosin, heavy chain 3, skeletal muscle, embryonic [ Homo sapiens ] |
Official Symbol | MYH3 |
Synonyms | MYH3; myosin, heavy chain 3, skeletal muscle, embryonic; myosin-3; myosin, skeletal, heavy chain, embryonic 1; myosin heavy chain, fast skeletal muscle, embryonic; myosin, heavy polypeptide 3, skeletal muscle, embryonic; HEMHC; SMHCE; MYHSE1; MYHC-EMB; |
Gene ID | 4621 |
mRNA Refseq | NM_002470 |
Protein Refseq | NP_002461 |
◆ Recombinant Proteins | ||
MYH3-5804H | Recombinant Human MYH3 Protein, GST-tagged | +Inquiry |
MYH3-29215TH | Recombinant Human MYH3 | +Inquiry |
Myh3-8017R | Recombinant Rat Myh3 protein, His & T7-tagged | +Inquiry |
MYH3-3847R | Recombinant Rat MYH3 Protein | +Inquiry |
MYH3-1840H | Recombinant Human MYH3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYH3-4032HCL | Recombinant Human MYH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYH3 Products
Required fields are marked with *
My Review for All MYH3 Products
Required fields are marked with *