Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MYL2, His-tagged

Cat.No. : MYL2-27837TH
Product Overview : Recombinant full length Human Myosin Light Chain 2 with N-terminal His tag; 186aa, 20.9 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.
Protein length : 166 amino acids
Conjugation : HIS
Molecular Weight : 20.900kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.24% Tris, 20% Glycerol, 0.05% Calcium chloride
Storage : Please see Notes section
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSM FEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETIL NAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD
Sequence Similarities : Contains 3 EF-hand domains.
Gene Name : MYL2 myosin, light chain 2, regulatory, cardiac, slow [ Homo sapiens ]
Official Symbol : MYL2
Synonyms : MYL2; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; cardiac ventricular myosin light chain 2; CMH10;
Gene ID : 4633
mRNA Refseq : NM_000432
Protein Refseq : NP_000423
MIM : 160781
Uniprot ID : P10916
Chromosome Location : 12q24.11
Pathway : CDC42 signaling events, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem;
Function : actin monomer binding; calcium ion binding; myosin heavy chain binding; protein binding; structural constituent of muscle;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends