Recombinant Human MYL2, His-tagged

Cat.No. : MYL2-27837TH
Product Overview : Recombinant full length Human Myosin Light Chain 2 with N-terminal His tag; 186aa, 20.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 166 amino acids
Description : Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.
Conjugation : HIS
Molecular Weight : 20.900kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.24% Tris, 20% Glycerol, 0.05% Calcium chloride
Storage : Please see Notes section
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSM FEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETIL NAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD
Sequence Similarities : Contains 3 EF-hand domains.
Gene Name MYL2 myosin, light chain 2, regulatory, cardiac, slow [ Homo sapiens ]
Official Symbol MYL2
Synonyms MYL2; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; cardiac ventricular myosin light chain 2; CMH10;
Gene ID 4633
mRNA Refseq NM_000432
Protein Refseq NP_000423
MIM 160781
Uniprot ID P10916
Chromosome Location 12q24.11
Pathway CDC42 signaling events, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem;
Function actin monomer binding; calcium ion binding; myosin heavy chain binding; protein binding; structural constituent of muscle;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL2 Products

Required fields are marked with *

My Review for All MYL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon