Recombinant Human MYL2, His-tagged
Cat.No. : | MYL2-27837TH |
Product Overview : | Recombinant full length Human Myosin Light Chain 2 with N-terminal His tag; 186aa, 20.9 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. |
Protein length : | 166 amino acids |
Conjugation : | HIS |
Molecular Weight : | 20.900kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.24% Tris, 20% Glycerol, 0.05% Calcium chloride |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSM FEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETIL NAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD |
Sequence Similarities : | Contains 3 EF-hand domains. |
Gene Name : | MYL2 myosin, light chain 2, regulatory, cardiac, slow [ Homo sapiens ] |
Official Symbol : | MYL2 |
Synonyms : | MYL2; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; cardiac ventricular myosin light chain 2; CMH10; |
Gene ID : | 4633 |
mRNA Refseq : | NM_000432 |
Protein Refseq : | NP_000423 |
MIM : | 160781 |
Uniprot ID : | P10916 |
Chromosome Location : | 12q24.11 |
Pathway : | CDC42 signaling events, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; |
Function : | actin monomer binding; calcium ion binding; myosin heavy chain binding; protein binding; structural constituent of muscle; |
Products Types
◆ Recombinant Protein | ||
MYL2-10314M | Recombinant Mouse Myl2 Protein, Myc/DDK-tagged | +Inquiry |
MYL2-1467H | Recombinant Human MYL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYL2-5808H | Recombinant Human MYL2 Protein, GST-tagged | +Inquiry |
Myl2-4250M | Recombinant Mouse Myl2 Protein, Myc/DDK-tagged | +Inquiry |
MYL2-3513R | Recombinant Rat MYL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
MYL2-4028HCL | Recombinant Human MYL2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket