Recombinant Human MYL4
| Cat.No. : | MYL4-29362TH | 
| Product Overview : | Recombinant full length Human MYL4 with an N terminal proprietary tag; Predicted MWt 47.41 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 197 amino acids | 
| Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. | 
| Molecular Weight : | 47.410kDa inclusive of tags | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFD PKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGD VLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPIL QHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLA TLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG | 
| Sequence Similarities : | Contains 3 EF-hand domains. | 
| Gene Name | MYL4 myosin, light chain 4, alkali; atrial, embryonic [ Homo sapiens ] | 
| Official Symbol | MYL4 | 
| Synonyms | MYL4; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; myosin light chain 4; ALC1; AMLC; GT1; myosin; atrial/fetal muscle; light chain; PRO1957; | 
| Gene ID | 4635 | 
| mRNA Refseq | NM_001002841 | 
| Protein Refseq | NP_001002841 | 
| MIM | 160770 | 
| Uniprot ID | P12829 | 
| Chromosome Location | 17q21-qter | 
| Pathway | Muscle contraction, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; Striated Muscle Contraction, organism-specific biosystem; | 
| Function | actin filament binding; actin monomer binding; calcium ion binding; myosin II heavy chain binding; structural constituent of muscle; | 
| ◆ Recombinant Proteins | ||
| MYL4-1355H | Recombinant Human MYL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| Myl4-4252M | Recombinant Mouse Myl4 Protein, Myc/DDK-tagged | +Inquiry | 
| MYL4-1565H | Recombinant Human MYL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| MYL4-6761HF | Recombinant Full Length Human MYL4 Protein, GST-tagged | +Inquiry | 
| MYL4-5811H | Recombinant Human MYL4 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MYL4-4026HCL | Recombinant Human MYL4 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL4 Products
Required fields are marked with *
My Review for All MYL4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            