Recombinant Human MYLK3 Protein, GST-tagged
Cat.No. : | MYLK3-5382H |
Product Overview : | Human MLCK partial ORF ( NP_872299.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Phosphorylation of cardiac myosin heavy chains (see MYH7B, MIM 609928) and light chains (see MYL2, MIM 160781) by a kinase, such as MYLK3, potentiates the force and rate of cross-bridge recruitment in cardiac myocytes (Chan et al., 2008 [PubMed 18202317]).[supplied by OMIM |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHLERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAAVDRA |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYLK3 myosin light chain kinase 3 [ Homo sapiens ] |
Official Symbol | MYLK3 |
Synonyms | MYLK3; myosin light chain kinase 3; putative myosin light chain kinase 3; caMLCK; MLC kinase; MLCK; cardiac-MyBP-C associated Ca/CaM kinase; cardiac-MyBP-C-associated Ca/CaM kinase; MLCK2; MGC126319; MGC126320; |
Gene ID | 91807 |
mRNA Refseq | NM_182493 |
Protein Refseq | NP_872299 |
MIM | 612147 |
UniProt ID | Q32MK0 |
◆ Recombinant Proteins | ||
MYLK3-8033H | Recombinant Human MYLK3 protein, His & T7-tagged | +Inquiry |
MYLK3-3859R | Recombinant Rat MYLK3 Protein | +Inquiry |
MYLK3-5850M | Recombinant Mouse MYLK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYLK3-10323M | Recombinant Mouse MYLK3 Protein | +Inquiry |
Mylk3-8034M | Recombinant Mouse Mylk3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYLK3-4015HCL | Recombinant Human MYLK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYLK3 Products
Required fields are marked with *
My Review for All MYLK3 Products
Required fields are marked with *
0
Inquiry Basket