Recombinant Human MYLK3 Protein, GST-tagged

Cat.No. : MYLK3-5382H
Product Overview : Human MLCK partial ORF ( NP_872299.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Phosphorylation of cardiac myosin heavy chains (see MYH7B, MIM 609928) and light chains (see MYL2, MIM 160781) by a kinase, such as MYLK3, potentiates the force and rate of cross-bridge recruitment in cardiac myocytes (Chan et al., 2008 [PubMed 18202317]).[supplied by OMIM
Molecular Mass : 36.74 kDa
AA Sequence : MDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHLERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAAVDRA
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYLK3 myosin light chain kinase 3 [ Homo sapiens ]
Official Symbol MYLK3
Synonyms MYLK3; myosin light chain kinase 3; putative myosin light chain kinase 3; caMLCK; MLC kinase; MLCK; cardiac-MyBP-C associated Ca/CaM kinase; cardiac-MyBP-C-associated Ca/CaM kinase; MLCK2; MGC126319; MGC126320;
Gene ID 91807
mRNA Refseq NM_182493
Protein Refseq NP_872299
MIM 612147
UniProt ID Q32MK0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYLK3 Products

Required fields are marked with *

My Review for All MYLK3 Products

Required fields are marked with *

0
cart-icon