Recombinant Human MYLPF, His-tagged
| Cat.No. : | MYLPF-30271TH |
| Product Overview : | Recombinant full length Human MYLPF with an N terminal His tag; 189aa, 21.2kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 169 amino acids |
| Description : | Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti |
| Conjugation : | HIS |
| Molecular Weight : | 21.200kDa inclusive of tags |
| Tissue specificity : | Expressed in fetal and adult skeletal muscle. |
| Form : | Liquid |
| Purity : | by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE |
| Sequence Similarities : | Contains 3 EF-hand domains. |
| Gene Name | MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ] |
| Official Symbol | MYLPF |
| Synonyms | MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory; |
| Gene ID | 29895 |
| mRNA Refseq | NM_013292 |
| Protein Refseq | NP_037424 |
| Uniprot ID | Q96A32 |
| Chromosome Location | 16p11.2 |
| Pathway | ErbB1 downstream signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; |
| Function | calcium ion binding; structural constituent of muscle; |
| ◆ Recombinant Proteins | ||
| MYLPF-4741H | Recombinant Human MYLPF protein, His-SUMO-tagged | +Inquiry |
| MYLPF-30271TH | Recombinant Human MYLPF, His-tagged | +Inquiry |
| MYLPF-324HF | Recombinant Full Length Human MYLPF Protein | +Inquiry |
| MYLPF-7854H | Recombinant Human MYLPF protein, His-tagged | +Inquiry |
| MYLPF-4220C | Recombinant Chicken MYLPF | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYLPF-4013HCL | Recombinant Human MYLPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYLPF Products
Required fields are marked with *
My Review for All MYLPF Products
Required fields are marked with *



