Recombinant Human MYLPF, His-tagged

• Cat.No.: MYLPF-30271TH
• Product Overview: Recombinant full length Human MYLPF with an N terminal His tag; 189aa, 21.2kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 169 amino acids
• Description: Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti
• Conjugation: HIS
• Molecular Weight: 21.200kDa inclusive of tags
• Tissue specificity: Expressed in fetal and adult skeletal muscle.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
• Sequence Similarities: Contains 3 EF-hand domains.

Gene Information

• Gene Name: MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ]
• Official Symbol: MYLPF
• Synonyms: MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory
• Gene ID: 29895
• mRNA Refseq: NM_013292
• Protein Refseq: NP_037424
• Uniprot ID: Q96A32
• Chromosome Location: 16p11.2
• Pathway: ErbB1 downstream signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem
• Function: calcium ion binding; structural constituent of muscle