Recombinant Human MYO1A protein, His-tagged
Cat.No. : | MYO1A-5307H |
Product Overview : | Recombinant Human MYO1A protein(NP_001242970)(1-350 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MPLLEGSVGVEDLVLLEPLVEESLLKNLQLRYENKEIYTYIGNVVISVNPYQQLPIYGPEFIAKYQDYTFYELKPHIYALANVAYQSLRDRDRDQCILITGESGSGKTEASKLVMSYVAAVCGKGEQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFGKYMDIEFDFKGSPLGGVITNYLLEKSRLVKQLKGERNFHIFYQLLAGADEQLLKALKLERDTTGYAYLNHEVSRVDGMDDASSFRAVQSAMAVIGFSEEEIRQVLEVTSMVLKLGNVLVADEFQASGIPASGIRDGRGVREIGEMVGLNSEEVERALCSRTMETAKEKVVTALNVMQAQYARDALAKNIY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MYO1A myosin IA [ Homo sapiens ] |
Official Symbol | MYO1A |
Synonyms | MYO1A; myosin IA; DFNA48, MYHL; unconventional myosin-Ia; myosin I heavy chain; brush border myosin I; myosin, heavy polypeptide-like (100kD); BBMI; MIHC; MYHL; DFNA48; |
Gene ID | 4640 |
mRNA Refseq | NM_001256041 |
Protein Refseq | NP_001242970 |
MIM | 601478 |
UniProt ID | Q9UBC5 |
◆ Recombinant Proteins | ||
MYO1A-6719C | Recombinant Chicken MYO1A | +Inquiry |
MYO1A-5307H | Recombinant Human MYO1A protein, His-tagged | +Inquiry |
MYO1A-10333M | Recombinant Mouse MYO1A Protein | +Inquiry |
MYO1A-5830H | Recombinant Human MYO1A Protein, GST-tagged | +Inquiry |
MYO1A-30273TH | Recombinant Human MYO1A | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYO1A-4010HCL | Recombinant Human MYO1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYO1A Products
Required fields are marked with *
My Review for All MYO1A Products
Required fields are marked with *