Recombinant Human MYO1F Protein, GST-tagged

Cat.No. : MYO1F-5837H
Product Overview : Human MYO1F partial ORF ( NP_036467.2, 811 a.a. - 912 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Myosins are molecular motors that use the energy from ATP hydrolysis to generate force on actin filaments. The protein encoded by this gene is an unconventional myosin that may be involved in the intracellular movement of membrane-enclosed compartments. There is evidence to suggest that mutations in this gene can result in hearing loss. [provided by RefSeq, Jan 2017]
Molecular Mass : 36.96 kDa
AA Sequence : KKKVDIQALRGVSLSTRQDDFFILQEDAADSFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGDLAVLKVGGRTLT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYO1F myosin IF [ Homo sapiens (human) ]
Official Symbol MYO1F
Synonyms MYO1F; myosin IF; unconventional myosin-If; myosin-ID; myosin-Ie
Gene ID 4542
mRNA Refseq NM_001348355
Protein Refseq NP_001335284
MIM 601480
UniProt ID O00160

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYO1F Products

Required fields are marked with *

My Review for All MYO1F Products

Required fields are marked with *

0

Inquiry Basket

cartIcon