Recombinant Human MYO3B Protein, GST-tagged
| Cat.No. : | MYO3B-5840H |
| Product Overview : | Human MYO3B partial ORF ( NP_620482.1, 280 a.a. - 369 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes one of the class III myosins. Myosins are ATPases, activated by actin, that move along actin filaments in the cell. This class of myosins are characterized by an amino-terminal kinase domain and shown to be present in photoreceptors. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014] |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | RRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVEDAEKYCLEDDLVNLEVLDEDTIIHQLQKRYAD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYO3B myosin IIIB [ Homo sapiens ] |
| Official Symbol | MYO3B |
| Synonyms | MYO3B; myosin IIIB; myosin-IIIb; |
| Gene ID | 140469 |
| mRNA Refseq | NM_001083615 |
| Protein Refseq | NP_001077084 |
| MIM | 610040 |
| UniProt ID | Q8WXR4 |
| ◆ Recombinant Proteins | ||
| MYO3B-367H | Recombinant Human Myosin IIIB, GST-tagged, Active | +Inquiry |
| MYO3B-5840H | Recombinant Human MYO3B Protein, GST-tagged | +Inquiry |
| MYO3B-30277TH | Recombinant Human MYO3B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYO3B Products
Required fields are marked with *
My Review for All MYO3B Products
Required fields are marked with *
