Recombinant Human MYO3B Protein, GST-tagged

Cat.No. : MYO3B-5840H
Product Overview : Human MYO3B partial ORF ( NP_620482.1, 280 a.a. - 369 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of the class III myosins. Myosins are ATPases, activated by actin, that move along actin filaments in the cell. This class of myosins are characterized by an amino-terminal kinase domain and shown to be present in photoreceptors. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
Molecular Mass : 35.64 kDa
AA Sequence : RRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVEDAEKYCLEDDLVNLEVLDEDTIIHQLQKRYAD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYO3B myosin IIIB [ Homo sapiens ]
Official Symbol MYO3B
Synonyms MYO3B; myosin IIIB; myosin-IIIb;
Gene ID 140469
mRNA Refseq NM_001083615
Protein Refseq NP_001077084
MIM 610040
UniProt ID Q8WXR4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYO3B Products

Required fields are marked with *

My Review for All MYO3B Products

Required fields are marked with *

0
cart-icon