Recombinant Human MYOD1
Cat.No. : | MYOD1-28655TH |
Product Overview : | Recombinant fragment corresponding to amino acids 211-320 of Human MyoD1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a nuclear protein that belongs to the basic helix-loop-helix family of transcription factors and the myogenic factors subfamily. It regulates muscle cell differentiation by inducing cell cycle arrest, a prerequisite for myogenic initiation. The protein is also involved in muscle regeneration. It activates its own transcription which may stabilize commitment to myogenesis. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLD CLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAP SEGESSGDPTQSPDAAPQCPAGANPNPIYQVL |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name | MYOD1 myogenic differentiation 1 [ Homo sapiens ] |
Official Symbol | MYOD1 |
Synonyms | MYOD1; myogenic differentiation 1; MYF3, myogenic factor 3; myoblast determination protein 1; bHLHc1; MYOD; PUM; |
Gene ID | 4654 |
mRNA Refseq | NM_002478 |
Protein Refseq | NP_002469 |
MIM | 159970 |
Uniprot ID | P15172 |
Chromosome Location | 11p15 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem; |
Function | DNA binding; E-box binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
MYOD1-10349M | Recombinant Mouse MYOD1 Protein | +Inquiry |
MYOD1-167H | Recombinant Human MYOD1, GST-tagged | +Inquiry |
MYOD1-8857Z | Recombinant Zebrafish MYOD1 | +Inquiry |
MYOD1-5865M | Recombinant Mouse MYOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOD1-3871R | Recombinant Rat MYOD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOD1-4005HCL | Recombinant Human MYOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOD1 Products
Required fields are marked with *
My Review for All MYOD1 Products
Required fields are marked with *