Recombinant Human MYOD1
| Cat.No. : | MYOD1-28655TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 211-320 of Human MyoD1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | This gene encodes a nuclear protein that belongs to the basic helix-loop-helix family of transcription factors and the myogenic factors subfamily. It regulates muscle cell differentiation by inducing cell cycle arrest, a prerequisite for myogenic initiation. The protein is also involved in muscle regeneration. It activates its own transcription which may stabilize commitment to myogenesis. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLD CLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAP SEGESSGDPTQSPDAAPQCPAGANPNPIYQVL |
| Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
| Gene Name | MYOD1 myogenic differentiation 1 [ Homo sapiens ] |
| Official Symbol | MYOD1 |
| Synonyms | MYOD1; myogenic differentiation 1; MYF3, myogenic factor 3; myoblast determination protein 1; bHLHc1; MYOD; PUM; |
| Gene ID | 4654 |
| mRNA Refseq | NM_002478 |
| Protein Refseq | NP_002469 |
| MIM | 159970 |
| Uniprot ID | P15172 |
| Chromosome Location | 11p15 |
| Pathway | C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; Myogenesis, organism-specific biosystem; |
| Function | DNA binding; E-box binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| MYOD1-5788C | Recombinant Chicken MYOD1 | +Inquiry |
| MYOD1-10349M | Recombinant Mouse MYOD1 Protein | +Inquiry |
| MYOD1-143H | Recombinant Human MYOD1 protein, Arginine-tagged | +Inquiry |
| MYOD1-166H | Recombinant Human MYOD1, GST-tagged | +Inquiry |
| MYOD1-287H | Recombinant Human MYOD1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYOD1-4005HCL | Recombinant Human MYOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOD1 Products
Required fields are marked with *
My Review for All MYOD1 Products
Required fields are marked with *
